KEGG   Sinocyclocheilus anshuiensis: 107674246Help
Entry
107674246         CDS       T04917                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00020  Citrate cycle (TCA cycle)
sanh00640  Propanoate metabolism
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sanh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107674246
   00640 Propanoate metabolism
    107674246
Enzymes [BR:sanh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107674246
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107674246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 107674246
NCBI-ProteinID: XP_016323663
Position
Unknown
AA seq 324 aa AA seqDB search
MSHSRLFARLLLQQAGVRHCYTGNRKNLYINKNTKVICQGFTGKQGTFHSQQSLDYGSQL
VGGVSPGKGGKTHLGLPVFNSVKEAKDGTGADATVIYVPPPFAAAAIIEAIDAEIPLAVC
ITEGIPQQDMVRVKHKLLRQSKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIGEIGGDA
EENAAEYLKQHNSGASAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VIVSMSPAQLGSTMYKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatagcaggttgtttgcccgcttgctcttgcagcaggctggggtgagacactgt
tacactggcaacaggaagaacctttacatcaacaagaacactaaggtcatatgtcagggc
ttcacaggaaaacagggcacctttcacagtcagcagtctttggactatggctctcagtta
gtaggaggagtgtctccaggcaaggggggcaaaacacacctgggtctgccagtcttcaac
tctgtgaaggaggctaaggatggcacaggggctgatgccaccgtgatctacgtgccacct
ccttttgcagcagccgccatcatcgaagcgattgacgcagagataccactggccgtctgt
atcacagagggaatccctcagcaggacatggtgcgggtcaaacacaagctgctccgccag
agcaagacccgcctcgtcggccccaactgtcccggtgtcatcaaccctggcgagtgtaaa
attgggatcatgcctgggcacatccacaagaaaggaagaattggcattgtatctagatcg
ggcactcttacgtatgaagccgtacatcagacgacacaagtgggtctgggccagtcactg
tgtgttggtattggtggagacccttttaatggcactaacttcattgactgcctggaggtg
ttcctgcaggacccaaaaactgagggcatcattttgattggagagattggaggagatgca
gaagagaatgcggcagagtacctgaaacagcacaactctggtgccagtgctaagcctgtg
gtgtcatttattgctggcttgacggcccctcctggaaggagaatggggcacgcaggagcc
atcattgccggaggcaaagggggtgccaaagagaagatcgccgccttgcagtcagctgga
gtcatcgtcagcatgtctccggctcagctgggcagcaccatgtacaaggagtttgagaag
aggaaaatgttgtaa

DBGET integrated database retrieval system