KEGG   Sinocyclocheilus anshuiensis: 107674496Help
Entry
107674496         CDS       T04917                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107674496
Membrane trafficking [BR:sanh04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107674496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 107674496
NCBI-ProteinID: XP_016323963
Position
Unknown
AA seq 1954 aa AA seqDB search
MAMASLPASERRAFALKINRHSSAEIRRHFSGISHGSLPHHRHSYSASGSFCFNIPQSYE
AVEPVDLDEFLMSQLCSGDAELMQELGEFPDDDLEVELVERECRTIRPSVPEEGVELDPH
VRDCVQSYTQPWLVVSRRSQGYGWIAYAERTDANRVLQRQTFESDVEPDKQEQVEKSPSL
PALCDDTTRTTLTCSDFNLRALQPDHRVESLLRFSSPEELDRFNLEARNSNRYGELFGLY
PPIDEEDAVAIRPIPDCPKEHFGQRILVRCQTIKFEIEIEPLFATMALYDLKEKKKISEN
VHFDMNSDQMKGFLRSHTPHTDPSTLARSAIFSISYPSPDIYLVIREGERLSDEDLFKFL
ADIKRSSGQRRVKIIPGFLRLEVSPVPETVPGCLCPELIPVKPVSEKNPRAVKEVLEFPS
SEVYVPHNIYQNLLYVYPLRLNLTNRLTSARNITVKIQFMSGEDPSCAMPVIFGKSSGPE
FLKEVYTPVTYHNRSPDFYDEIKIHLPARLTEKHHLLFTFYHISCQQKQNQTGSLETLIG
YSWLPLLNNDRLQTGQQCLPIVLDKLPVNYSLHSPEKLPAQVPPVKWLENHKGLFNLELQ
AVSSVQTQDSHLERFCTLCHALEGKTIFPIRVGDEKISENMFEHELKLSIISLSSSGLEP
LVLFLHQVLDKLFRLIMQPMVIAGQTANLAQIAFESVVSVVNSLHNSQELAKDHQGRNCL
LATYLYFVFRLPDTQHEIHTSGTGGLMAHPESRYSTLTRATATTVGFMLLQSRIRSSSNP
DIPAPQSPEDAEVNNILGKQGLNLPGSRISAAGKVSNSSQSSSTRPTNRKLFHEELALQM
VVSTGVCRENVYKYAWFFFELLVKSMSQHVSQLDKKAVSRRNRFSDRFKDDITTIVNVVT
AEIGNILVKQQKELEQAEKVNISLAFFLYDLMSLMDRGLVFQLVKNYCNQMAAKSVSMST
LISMRLEFLRVLCSHEHYLNLSLFFSSPASAPASPSPSTSSQTSSLCSFQDHKIAAMFDL
SQDFKQRHYLTGLLLTELSTALDMESEGGRVQQKAINATYSLLCAHDLDQRCSRPEVKAK
IAALYLPLVGIIIDSINYLDFTVSDSRGGKGKSGGPEEDPDSITPINQSVAMAIAGNPFN
TLARNALVSMASVTGKTSNMLTAETSRNLLMCFLWIIKNADQNLIQRWTVDVPSSQLSRL
LELLAICISCFEYRGKQSSDKVSTQALQKSQQAKARLEEALLGGIGARGEMMKRVGGNDR
TLGQRENLRWRKDLTQWRQTNDRQDKSKAELDQEAIISGNLATETNLIVLDLLEMIVQAV
PLADCKDNVVGGVLKVLLHSLTCNQSTTFLSHCFSTLRALIVKFGDLLFEEEAEQCADLC
QKVLHYCSSCVDGNRSQACATLYLIMRYSYSSASNFSRVKMQVTMSLASLVGKSSDIHEE
YLRRSFRTILAYAEEDTEMQSTQLPSQVDELLRNLNSILSDTVKMKEFQKDPEMLMDLMY
RIAKGYQTSPDLRLTWLQNMAEKHNSRKCFTESAMCLVHAAALVAEYLSMLEDHKYLPVG
SVTFQNISPNNKDGVCSGRYFTESGLVGLLEQAAELFSNGGLYEAVNEVYKVIVPILEAH
RDFRKLASTHDKLQRAFENIIQKGHKRMFGTYFRVGFYGCKFGDLDEQEFIYKEPGITHL
PEISHRLENFYSQCFGDGVLEMIKDSTPVDRKKLNPSKAYIQITFVEPYFDDYEMKDRLT
NFEKNFNLRRFMYTTPFTKSGRPRGELNEQYKRKTILTTMHAFPYIKTRINVIQKEEFDL
TPIEVAIEDMQKKTRELAEATHREKPDAVMLQMVLQGSVTATVNQGPLEVAQVFLNEIPA
DPKLFRHHNKLRLCFKEFILRCGQAVEKNKLLITPDQKEYQQEMKKNYNKLRENLRPMLE
RKIPELYKPIIKPRIENRDSFKRQSLRRTQDENS
NT seq 5865 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcttctctgccagcgtcagagcggagagcattcgctctcaaaatcaacaga
cactcctcggcggagatccggagacacttcagtgggatcagccatggttccctgcctcac
caccggcacagttacagcgcctctggctctttctgcttcaacatacctcagtcatatgaa
gcagttgagccggtggacctggatgagttcctgatgtcacagctgtgcagtggagatgcc
gagctcatgcaggagctgggggagtttccagacgacgacctggaggtggagctggtggag
agggaatgcaggaccatccgcccctctgtccccgaggaaggagtggagctggatcctcat
gtgagggattgtgttcagagttacacgcagccctggctggtggttagcagaagatctcag
ggttatgggtggattgcgtacgccgagaggacagatgctaacagagtcttacagagacag
acgtttgagtctgacgttgagcctgacaaacaagagcaagtagaaaaatcaccgtccctg
ccagcactatgtgatgatacaactcggaccaccctcacatgctcagacttcaacttacgg
gccctgcagccggaccatcgtgtggagagcctcttgcgcttcagcagcccggaggagctg
gatcgtttcaacctggaggccagaaatagcaaccgctatggcgagctctttggcctctac
ccacctattgatgaggaggatgcagtagcgattcggcccattcccgactgtcccaaggag
cactttgggcagaggatactagtgcgatgccagaccatcaaatttgagattgaaattgag
cccctctttgcaaccatggccctctatgacctgaaggagaaaaagaagatttcagagaac
gtccactttgacatgaactccgatcagatgaagggtttcctgcggtctcacactccccac
actgacccctccactttggccagatctgcaattttctccatctcctacccttctccagat
atctatctggtcattagggaaggagagcgtctgagtgacgaggacttgttcaagtttctg
gcggacatcaagaggtcgtccggtcagcgacgtgttaaaatcatacctggttttctgaga
ctggaagtgtctccagtgccggagacggttcctgggtgtctgtgcccagaactgattcca
gtgaagccagtttctgagaaaaatccacgggcggttaaagaagtgctggagttcccttcc
agtgaagtctatgtgcctcacaatatataccagaacctgctgtatgtgtatcctctgagg
ttgaatcttactaaccgtttgacttcagccagaaacattacggttaaaatccagttcatg
agtggtgaggatcctagctgtgccatgcctgtaatctttggaaaatcaagcggccctgag
tttcttaaagaggtctacactccagtcacataccacaacaggtctcctgatttctatgac
gagataaagatccatcttccagcccgtttaacagagaaacatcacttactgttcaccttt
taccatatcagctgccagcagaaacagaaccagactggaagtctggagactctcattgga
tattcatggttacccttgctgaacaatgacaggctgcagactgggcagcagtgtctgcca
atcgttctggacaaacttcctgtgaactactccctgcattccccagagaaactgccagct
caggtacctcctgttaagtggttggagaatcataagggactgttcaaccttgagctacaa
gctgtgtcctcagtccaaacacaggacagtcacctggagcgtttctgtactctgtgtcac
gccctggagggcaagaccatattccctattcgagtgggagatgagaagatttctgaaaac
atgtttgagcacgagctgaagctcagcatcatctcgctgtcatcctccggcctggagccg
ctggtgctgtttctccatcaggtcctcgacaagctcttccgtctcatcatgcagcccatg
gtcatcgccggacagactgcaaatctggcccagattgcatttgagtcagtggtgtcggtt
gtcaacagtcttcacaacagtcaggagctggcaaaggaccatcagggaagaaactgtctc
ctagcaacatacctgtactttgtgttccgcttgccagacacacaacatgaaatccacacc
tcaggcacaggaggtctgatggctcacccagagagccgatacagcactctgactcgcgcc
acggccaccacggtcggcttcatgctgcttcagtcacgcattcgttccagcagcaaccct
gatataccagcaccacagagcccagaggacgcagaggtcaataacattctaggaaagcag
ggtttaaatcttcctggcagtcgcatctcagcagctggaaaagtctccaatagttcacaa
agctcaagcacacggcccacaaacagaaagttgttccatgaggagctggctcttcagatg
gtggtcagcactggagtctgcagagagaacgtctacaaatacgcctggttcttctttgaa
cttcttgtgaagagcatgagccagcatgtgtctcagctggataagaaggcagtctctcgt
aggaatcggttttcggatcgtttcaaagatgacatcaccaccattgtcaacgtggtaact
gctgagattggaaacattttagtaaaacaacaaaaggagctagagcaggcagagaaggtt
aacatcagcctggctttcttcctgtatgacctgatgtctctgatggaccgtggcttagtg
tttcagctggtgaagaattactgcaaccagatggcagcaaagagcgtgagcatgtcgact
ttgatcagtatgaggttggagtttttgagggtcctgtgcagtcatgagcattacctcaat
ctgagcctgttcttcagcagccctgcttctgcgcccgcctccccgtcaccctccacctcc
tcacagacctccagcttgtgcagttttcaggaccataagatcgcagccatgtttgatctg
tcacaagactttaagcagcggcattacttgaccggactgctgctgaccgaactcagcact
gcactggacatggagtcagagggggggagagtacaacaaaaggccatcaatgccacatac
agcttattgtgcgctcacgatctggaccagcgctgctccaggccagaggtcaaggctaag
attgctgctctctacctccctctagtgggcatcatcattgactccatcaattaccttgac
ttcacagtatctgactcgcgtggcggtaaaggcaagtccggtgggcctgaggaagatcct
gacagcatcacccccatcaatcaatctgttgcaatggcaatcgctggaaatcctttcaac
actttagcgagaaatgcactggtctctatggcctctgtgacggggaaaactagcaacatg
ttgacagcagagaccagtcgcaatctgctcatgtgtttcctgtggattatcaagaacgca
gatcagaatctgatccaacgctggactgtggacgtgccttcatctcagctgagccgtctg
ctggagctcctcgccatctgcatctcctgctttgagtacagggggaagcagagttctgat
aaggtgagcacacaggccctgcagaagtctcagcaggctaaggcgcgtctggaggaggct
ctgctgggaggaatcggagccagaggagaaatgatgaaaagggtgggaggtaacgaccgg
acgctgggtcagagagagaacctacgctggaggaaagaccttacacagtggcgccagaca
aacgacaggcaggacaaatccaaagcagagctggatcaggaggccataatcagtggtaac
ctggcaactgagaccaacctcatagtcctggacctgctggagatgatcgtacaggcagtt
cctctggccgactgtaaggataatgtggttggtggagtgttgaaggttctgctgcactct
ctcacctgtaatcagagcaccaccttcctgtcacactgtttcagcaccctacgggctctc
atagttaagtttggtgacctgttgtttgaggaggaggccgagcagtgtgctgacctgtgt
cagaaggttcttcattactgcagcagctgtgtggacggcaacaggagtcaggcttgtgct
acactgtacctgatcatgagatacagctacagctccgctagtaatttctccagagtcaag
atgcaggtgacaatgtctttagcctcgctggtcggcaagtcttcggacatccatgaggag
tacctacgccgctctttcagaactatcctagcatacgcagaagaagacacggaaatgcag
tctacacagctgccctcacaggtggatgaactcttgaggaatctaaacagtatcctctca
gatacagtcaagatgaaagagttccagaaagatcctgagatgcttatggacctcatgtat
aggatcgcaaagggttaccagacatctccagacctgcgtctaacctggctccaaaacatg
gcagagaagcacaacagcaggaagtgctttacagagtcagccatgtgtctggtccatgcc
gcggccctggtggctgaatatctcagcatgctggaggatcacaaatacttgcctgtgggc
agcgtcacctttcaaaacatctctcctaataacaaggatggggtttgctcgggacgctac
ttcacggaaagtggcctagttgggcttctggaacaggctgctgagctattcagcaatggc
gggttgtatgaggcagttaatgaggtgtacaaggtaatcgtgcctatactggaggcccac
agagatttccggaagctcgcttccacacatgacaagctccaaagggcttttgagaacatc
attcaaaagggtcacaagaggatgtttggaacctacttccgcgtgggattttatggctgt
aaatttggagaccttgatgagcaagaatttatctacaaagagccaggaattacccattta
ccggagatatcccaccggctcgagaacttttacagtcagtgttttggagatggagttttg
gaaatgattaaagattccacaccagtagacagaaagaagctcaatcccagcaaggcgtac
atacagattacctttgtggagccttactttgatgactatgagatgaaagaccgcctcacc
aactttgagaagaacttcaaccttcgccgcttcatgtacactacgccgttcacaaagagt
gggcggccccgaggggaactcaacgagcaatacaagcggaaaaccatcctaaccaccatg
catgccttcccctacatcaagacccggatcaacgtcattcagaaggaggagtttgacctc
acacccatcgaggtggccattgaggacatgcagaagaagactagagagctggctgaagcc
acgcacagagagaagccagatgctgtgatgcttcagatggttctgcagggatctgtcaca
gccaccgtcaatcagggtccattggaggtggcccaggtcttcttgaatgaaatcccagca
gaccccaagctcttccgtcatcacaacaaactgcgtttgtgtttcaaagagttcatactg
cggtgtggacaggccgttgagaagaacaagctactcattactcctgatcagaaggagtac
cagcaggagatgaagaaaaactacaacaaactgcgagagaacctgaggcccatgctggag
agaaagatccctgagctctacaagcccatcatcaaacctcgcatcgagaatagagattcc
ttcaaacggcagagcctccgtcggacacaagatgaaaattcatga

DBGET integrated database retrieval system