KEGG   Sinocyclocheilus anshuiensis: 107675834Help
Entry
107675834         CDS       T04917                                 

Definition
(RefSeq) ras association domain-containing protein 5-like
  KO
K08015  Ras association domain-containing protein 5
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107675834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2 Ras_bdg_2 CaKB
Motif
Other DBs
NCBI-GeneID: 107675834
NCBI-ProteinID: XP_016325792
Position
Unknown
AA seq 485 aa AA seqDB search
MASVTLGQHPAQHHLDSDQQLFHKLKSSDGKKFTRKWSLDKIIMRNRASDVDGARAEVSA
SLVLFNHEPPSASHSRGCSAGSPPSNMNRSIVDMDRENANNNNGIFRRHSARSRRSSVKD
TAKIHASSSPQEVRNSSTRSNLSCPPDELEGLPIDKLTQARSGVVKMRSEPLRREAWSIF
NQKDPRVKAEKGEGHIFISRQLSQDWCDACNRQISSAALKCRNCSYTCHLECQGLVQLDC
NQLDQPTEDVSTPAPQRPAAKDPQETDVTREEEEEKPTSLTDEEIKAKIDDYNSKVTENG
MKISSDGTYTGFIKVHLKLRRPVTVSVDGKSPGPCSSSDSSDNRTSFYLPRDAIKQLHIS
STTTVREVIQGLLKKFMVQDNPCKFALYHQTRRDSQDLFQKLPLSECPLCLRLLAGPDLE
NLSFVLKENETGEVEWHAFSVPELQNFLIILEKEENERVRQVEQRYAAYREKLLQALGQV
ESKPG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtcacgttaggacagcaccctgctcaacaccacctcgactcggatcagcaa
ctatttcacaaactgaagtcgagcgacgggaagaaattcacgcgcaagtggtcgctggac
aagatcatcatgcgaaacagagcgagtgatgtggacggcgcgagagccgaagtctcagca
tcgctcgtgttattcaatcacgagcccccttcagcatcacacagccgaggctgtagtgcc
ggttcgccacctagtaatatgaacagatcgattgtggacatggaccgagagaacgccaac
aataataacgggatatttcgcagacacagtgccaggagccggagaagctcagtgaaggac
acggcaaagatccacgcgtcttcgtcaccacaagaagttcgcaattcctcgacgcggtca
aacttaagctgcccgccagacgaactggagggactgccgatcgacaagctgacacaggct
aggtcaggagtagtgaagatgcgaagcgagcctctcaggagggaggcatggtccatcttc
aaccagaaagacccgagggtgaaggcagagaagggagagggccacatcttcatctccagg
cagctgagccaggactggtgcgacgcctgcaaccgccagatcagcagcgctgcgctcaag
tgtcgaaactgcagctacacatgtcatttggagtgtcaggggcttgtccagctggactgc
aaccaactagaccagccgacagaggatgtgtctacccccgctccacagaggcccgccgcc
aaagaccctcaggagacggatgtgacaagagaggaagaggaagagaagccaacatccctc
acagacgaagagattaaagcgaaaatagatgactacaactccaaagtgacagagaatgga
atgaaaataagctcagatggcacatacactggtttcataaaggttcacttgaagttgcgc
aggcctgtgactgtttctgtggatgggaagtcaccaggaccatgttcctcttctgatagt
tcagataaccgcacatccttctacctgcccagggatgccattaaacagctacacatcagc
agtaccaccacggtcagggaggtcatccagggcctgctgaagaagttcatggtacaggat
aacccatgcaagttcgccctctaccaccagacccgtcgagacagccaggatcttttccag
aagttgccattatcagaatgtccactctgcttgaggctgttagcaggtcctgatctagag
aacttgtcctttgtactcaaagaaaatgagactggcgaggttgagtggcatgcattttca
gtccctgagctgcagaacttcctgatcatcctggagaaggaggagaatgagcgtgtgcgg
caggtggagcagcgttacgctgcctacagggagaagttgctacaggctctaggtcaggtc
gagagcaagccgggctaa

DBGET integrated database retrieval system