KEGG   Sinocyclocheilus anshuiensis: 107676738
Entry
107676738         CDS       T04917                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) A-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107676738
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107676738
SSDB
Motif
Pfam: AstE_AspA DUF2399 RRM_1
Other DBs
NCBI-GeneID: 107676738
NCBI-ProteinID: XP_016326885
Position
Unknown
AA seq 312 aa
MKAVAMPTVSRVAVCGGTHGNELAGIYLVREMLKKRADGTEPVSVVTVMSNSRAAQLCVR
YVETDLNRCFTRAALSAPVSETSPYEMIRSQELNALLGPKASAQAVDLLCDLHNTTANTG
LCLITYSDHDWICLHICKHLQREMASTPVRYVHFDIPLNEAYSLDSVGKHGFAMEIGPQP
HGVVRSAIFSAMQEGVQLMMDWICQFNSGMLFEGGWVDVYTMVKNIDYPRDSETHVITAA
VHPDLQDRDFCLLHPGDPMFLCFSGETLRYRGKEALYPFFINEGAYYEKGVALSLARKRR
VQIPSVRSETLR
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaggcggttgctatgccaacggtgtcgcgagtggcggtttgcggcggtacccatggc
aatgagcttgcaggcatctatctggtgagggagatgctgaagaagcgggcggatgggaca
gagccggtttccgtggtaacggtgatgtcgaactcgcgtgccgcgcagctgtgtgtgcgt
tatgtggagacggacctgaaccgctgcttcacgcgagccgcgctcagcgcacccgtctcc
gagacctcgccgtacgagatgatccgctctcaggagctcaacgctcttctgggccctaaa
gcaagcgcgcaggcagtcgacctgctgtgtgacctgcacaacaccactgcaaacacaggg
ctgtgtctcatcacatactccgaccacgactggatctgcctgcacatctgcaaacacctg
cagagagaaatggcctccactcctgtcagatacgttcactttgatattcctctcaatgaa
gcctattctctggattcagtggggaagcatggatttgcgatggagattgggccacagcct
cacggcgtcgtcaggtctgcgatattcagcgccatgcaggaaggagttcagctgatgatg
gactggatctgtcagttcaactcagggatgctgttcgaaggaggatgggttgatgtgtac
acaatggtgaagaatatcgactatccacgagactctgaaacgcacgtgatcacggccgcg
gtccatcccgacctacaggatagagatttctgcctccttcaccccggagaccccatgttc
ctgtgtttctcaggggaaacgctgcgctacagagggaaagaagcactctatccattcttc
ataaacgagggtgcgtactatgagaagggtgtcgctctttccctcgctaggaagagaaga
gtgcagattccttcagtccgctcagaaacgctgagatga

DBGET integrated database retrieval system