KEGG   Sinocyclocheilus anshuiensis: 107677597Help
Entry
107677597         CDS       T04917                                 

Definition
(RefSeq) cyclin-dependent kinase 15 isoform X1
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107677597
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107677597
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107677597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 107677597
NCBI-ProteinID: XP_016328028
Position
Unknown
AA seq 448 aa AA seqDB search
MEDFLWRMRVWASLSLRRCCWCCGDKRNEVRREEKEEMFEMRVEEITEEIKTEEKPSKTW
SVSSLPVAELGELDGVEKPQPHWFHTLQVRRLRVQRGRSNSDPMGGKSFQQEFQWKTGLQ
FGNATSYLNLEKLGEGTYATVYKGISRINGHLVALKVIHMKTEEGIPFTAIREASLLKGL
KHANIVLLHDIIHTQESLTFVFEYVQTDLAQYMIQHPGGLHSYNIRLFMFQLLRGLSYIH
SRRILHRDLKPQNLLISYLGELKLADFGLARSMSIPCQTYSAEVVTLWYRPPDVLMGSTD
YSTALDIWGAGCIFIEMLQGSPAFPGVADVFEQLLKIWAVLGVPTEESWPGVSDLPNYKP
EWFLPCKAQQFRDVWKRLAQLPYKTEDLAQQMLMMNPKDRISAQDALLHPYFNTLPPPLM
HLRDTVSIFKVPGVRLEAETRDIFSPSR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttcctgtggagaatgcgggtctgggcgtctttgagcttgaggagatgttgt
tggtgttgtggagataaaagaaatgaagtcagaagggaagaaaaagaggaaatgtttgag
atgagagtggaagagataacagaagaaattaaaacggaagaaaaaccatcaaaaacttgg
agtgtgtcctccctcccagtcgctgagctgggtgagctggacggggtggagaaaccacag
ccgcactggtttcacacgctgcaggtgcgacggctcagagttcagaggggccgcagtaac
agcgatcctatgggaggaaagagcttccagcaagagttccagtggaaaactggcctgcag
tttgggaatgcaacatcttatctaaatcttgaaaaacttggagagggcacatatgccaca
gtgtacaaaggaattagcaggataaacggtcatcttgtggctttaaaggtgattcacatg
aaaactgaggaaggaattccattcacagctattagagaagcctccttgttaaagggcctt
aaacatgccaacatcgtcttgcttcacgacatcatccacacgcaagagtctctcactttt
gtctttgagtatgtgcaaacagatttggctcaatacatgattcagcatcctggcggtctt
cactcgtacaacattaggctctttatgtttcagttgctgcgaggattgtcttacattcac
agcagaagaattctgcatcgagacctcaaacctcagaatttgctcatcagttatttgggg
gagctcaaattagccgattttggtctggcccgatctatgtccataccatgccaaacatac
tcagccgaggtcgtgactttatggtaccgcccgccagatgttctcatgggctccactgat
tactccacagccctggacatctggggagctggctgcatttttatcgagatgctacagggg
tcaccagcgtttcctggagtagctgatgtctttgagcagctgctgaagatttgggctgtc
ctcggggtcccgaccgaggagagctggccaggtgtcagtgatctgccaaactataaacca
gagtggttcctgccctgcaaggcccagcaatttcgagatgtctggaaaagactcgctcag
ttaccctataagacggaggatctggcccagcagatgctgatgatgaatccaaaggacagg
atttcagcccaggatgcattgctacacccatatttcaacactcttccacctccgttaatg
catctaagggacactgtgtccatctttaaggtgccgggtgtgaggttagaggcggaaacg
agggatatcttcagccccagcagatga

DBGET integrated database retrieval system