KEGG   Sinocyclocheilus anshuiensis: 107677721Help
Entry
107677721         CDS       T04917                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00450  Selenocompound metabolism
sanh00970  Aminoacyl-tRNA biosynthesis
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107677721 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107677721 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sanh01007]
    107677721 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sanh03016]
    107677721 (mars2)
Enzymes [BR:sanh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107677721 (mars2)
Amino acid related enzymes [BR:sanh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107677721 (mars2)
Transfer RNA biogenesis [BR:sanh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107677721 (mars2)
 Prokaryotic type
   Other AARSs
    107677721 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 107677721
NCBI-ProteinID: XP_016328229
Position
Unknown
AA seq 599 aa AA seqDB search
MFAHATGSSSLVMRSPCRSLARARTALRLCSHALHGRLPRVYSIHDRQASRCSRPYYITT
PIFYVNASPHIGHVYSAVTADCLHRYKLLKGYDSRFATGTDEHGLKIQQAASSAGKEPLG
FCTEISQSFKHVFQRCSISYTDYIRTTEQRHRRAVEDFWTVLHSRGFLYKGTYEGWYSTP
DESFLSPAQVTDSTDSGGGRIKVSSESGHKVEWMKEDNYMFRLSDFRTELLRWLRSNPKV
IQPVKFHDFVLQWLEDDIPDLSVSRQKSRLRWGIPVPGDPEQTIYVWLDALVNYLTVVGY
PQNHSQWWTAVHHVVGKDILKFHAIYWPAFLMAAGLPLPQMIYVHSHWTVEGRKMSKSLG
NVINPLDAIEKFTVDGLRYFLLRQGIPDSDCDYYDDKVIKMCNSELADALGGLLNRCTAP
SINPTQVYPRFSNTCFPKEELGGRAVSDDYRMVEAVSALPVLVEQHFENLHIYKALEAIS
ACVRLTNGFVQRHAPWKLDRKQDRQWLDTILHVSLECLRVYGMLLQPVVPGLADKILSRL
GVTPEERSWDSVNFLMKYEGRDCGLEGRALGPDLGVLFSRLERSSVKGKTPKKATTQDE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctcacgcgaccgggagcagcagtctcgtgatgaggtctccgtgccgttctctc
gctcgagccagaaccgcactgagattatgcagtcacgcgctccacggaagacttccgcgc
gtctacagtattcacgaccgtcaggcttcgcgatgctcgagaccatattacatcacgacg
cccatcttctacgtcaacgcgtctcctcacatcggtcacgtgtactccgccgtcaccgcg
gactgtctgcacaggtacaaactcttaaagggatacgactccagattcgccacgggtacg
gatgaacatggtctgaagatccagcaggcagccagcagtgctggtaaagagcctctgggc
ttctgcactgagatatcacagagtttcaagcatgttttccaaagatgtagcatttcatac
actgactacatcagaaccacagagcaaaggcacagacgggctgttgaagacttctggacg
gtcctccacagcagaggcttcctctacaaaggcacgtatgaaggctggtactccactcca
gatgaaagttttctctctccagctcaagtcactgacagcacagactcaggaggaggacgg
atcaaagtatccagcgagagcggccacaaggtggagtggatgaaggaggacaattacatg
ttccgtctatcagactttcgcaccgaactgcttcgctggcttcgatcgaacccgaaggtc
atccagccggtgaagtttcacgactttgttctccagtggctggaggacgacatcccagat
ctgtcagtgtcccggcagaagagccggctccggtggggtatcccagtcccgggggatccg
gagcaaaccatctacgtttggctggacgctctggtgaactatttgacggtggtgggttac
cctcagaatcactctcaatggtggacagcggtgcatcacgtcgtgggtaaggacatcctc
aagtttcacgccatatactggcccgcgtttctcatggctgcggggttgcctcttcctcag
atgatatatgttcactctcactggacggtggagggaaggaagatgtccaagagtctcgga
aacgtgatcaacccattggacgccattgagaagttcaccgtggacggcttgagatacttc
cttctcagacaaggcattcctgattcggactgcgactattatgacgataaagtcattaag
atgtgcaacagcgagttagcggacgctctcggagggctgttaaaccgctgcaccgcgccc
tcgattaaccctacacaggtgtatcctcgcttctccaacacatgcttcccaaaggaagag
ctcggtggaagagccgtctcggatgattacagaatggtggaggctgtatcagcgcttcca
gtcttagtagagcagcactttgagaatctacacatctataaagcgctggaagccattagc
gcatgcgtgcgcctcactaacgggtttgtccaaagacacgccccgtggaagctggaccgg
aaacaagaccggcagtggcttgacaccatccttcatgtgtctttagagtgcctcagggtg
tatgggatgctcctgcaacctgtggtgccagggcttgccgataaaattttatcgaggctg
ggagtcacgcctgaggagagaagctgggattctgtcaacttcctgatgaaatatgaagga
cgagactgtgggttggaaggaagggcgctgggtcctgatttgggagtgttgtttagtcgt
ctggagaggagctcggtgaaagggaagactcccaaaaaggcaacaacacaagacgagtga

DBGET integrated database retrieval system