KEGG   Sinocyclocheilus anshuiensis: 107678484
Entry
107678484         CDS       T04917                                 

Definition
(RefSeq) uncharacterized protein LOC107678484
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107678484
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107678484
SSDB
Motif
Pfam: PAS
Other DBs
NCBI-GeneID: 107678484
NCBI-ProteinID: XP_016329244
Position
Unknown
AA seq 376 aa
MHQNVFDYIHVDDRQEFRRQLHWAMNPSAQSGSGEDLVVSSLFQSETGDVPPEFSCFLNR
CFILRVRCLLDSTSGFLTMQFQGRLKLLQGQRKKTASGALLRPQLALFCVAVPLLLPSIT
EMKMKSGVMKGKHRNPGVLTSLDHNDRDDALRRASLLSKDSVKYKSERPYGPDEPLSFCK
TSVQKFTNLDCSTWPSRSSSVLGKHYAKPYRSAPGYYSSRAEAFIPKPYGSDCGADKSEG
FCFDGYDAVLEPVVKVEQDSDSENGSWTQMKVEAGFGEQYSCQRLKGAPYAGHYYSSTRA
LKCVLNRDAAAASAHNTHCIDAYAADYRGYVQHDYKAGNEFKGHGLLHCIKQEPVDAPLW
HDMSGAHKTNPYVFMQ
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcatcagaacgtgttcgactacattcacgtagacgaccggcaggagttcagacggcag
ctgcactgggctatgaacccttcggctcaaagcggctcgggtgaagatctcgtggtcagc
agtttgtttcagtctgagacgggcgacgttcctccagagttctcctgcttcctaaaccgc
tgctttatcctgcgcgtccgctgcttactggacagcacctccggattcctgacgatgcag
tttcagggaagactgaagctccttcagggtcagaggaagaagacggcgtccggagcgctc
ctgcgtcctcagctagcgctgttctgtgtcgcggtgcctctgctcctgccctccatcacc
gagatgaagatgaagagcggcgtgatgaagggcaaacacaggaaccccggcgttctcacc
tcgttagatcacaatgacagagatgatgctctcagacgtgcctcgctcctgagcaaagac
agcgtcaagtacaagagcgaaaggccctacggccccgacgagcctctgagcttctgcaag
acgagcgttcagaagttcacaaacctggactgcagcacctggccctcgagaagctcctcg
gtcctcggcaaacactatgctaaaccgtatcgatcggccccgggatattacagctccaga
gccgaggccttcatccccaagccctacgggagcgactgcggcgcagacaagagcgagggc
ttctgcttcgacggatacgacgcggtgctggagccggtggtgaaggtggagcaggactcg
gactcggagaacggttcgtggacgcagatgaaagtggaggctggattcggagagcagtac
tcctgccagcggctgaagggagcgccatacgccggacattattacagctcgacccgagcg
ctcaagtgtgtcctgaaccgagacgcagcggccgccagcgcacacaacacacactgcatc
gatgcctacgctgctgactacagagggtacgtgcagcacgactataaagcgggtaacgag
ttcaaaggtcacgggctgcttcactgcatcaagcaggagccagtggacgctccgctgtgg
cacgatatgagcggcgcacacaagactaacccctacgtcttcatgcagtag

DBGET integrated database retrieval system