KEGG   Sinocyclocheilus anshuiensis: 107678679Help
Entry
107678679         CDS       T04917                                 

Definition
(RefSeq) galactocerebrosidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00600  Sphingolipid metabolism
sanh01100  Metabolic pathways
sanh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107678679
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107678679
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     107678679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 107678679
NCBI-ProteinID: XP_016329531
Position
Unknown
AA seq 672 aa AA seqDB search
MSSVVHTDAHLNMLTHNLLFTISCFLGCSAEFYVIDDRIGLGREFDGIGGLSGGGATSRL
LVNYEEPYRSHILDFLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMHSKDEGNFFRGYE
WWLMKEAKKRNPNIKLIGLPWAFPGWVGEGTQWPYFFPNVTADYVVTWIYGAKQHHNLEI
DYIGIWNEKKYDPVYIKVLRDTLDRVGYTNVGIIAADGDWSIAAAMLEDPYLNDAVEVIG
VHYPGTKTVKEALLTEKKLWSSEDYSTFDDDIGAGCWARILNQNYVNGRMTSTISWNLIA
SYYENLSFGGDGLMTADEPWSGHYVVESPIWMTAHTTQFTQPGWFYLQTVGNLTHGGSYV
ALTDRKGNLTVVIQTMTHNHSQCIRPPLPHFDVSPQIATFQLKGSFAHLTDLQVWYSKLD
FETKKDTLFQRSSPIKVYNGSFTLKLDVDEVYTITTVNTGQKGTYPESPNSRPFPKNYSD
DFTIDNPPFSEAPYFADQTGVFEYFRNSTDNGSHAFTLRQVVTERPVTWARDADQTISII
GDYSWTDLNVSCDVLIETPVTGGVFLAARIDQGGESVREAKGVFYWIYANGTYKVTNDIG
GQRVLAEGLSGTREGVWYTLTLRIKGYFATGMLNGYPLWKNAVVLEPKNGWTALGTLSFE
YAQFDNFEVNAE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagtcgttcatacagacgctcatctaaacatgctaacacacaatctgctgttc
accatctcctgctttctcgggtgctctgctgagttttatgttatagatgatcggattgga
ttagggagagaatttgatggaataggtggattaagtggaggaggagccacttcacgactt
cttgtcaactatgaagaaccgtatcggagtcatatactggatttcttgttcaagcccaac
tttggagcttcattgcacatcctaaaagtagaaataggaggcgatgctcaaaccacagat
ggcacagaaccctctcacatgcacagtaaggatgaaggcaattttttccgtggatatgag
tggtggcttatgaaagaagccaagaagagaaatccaaacatcaagctgattggtcttccc
tgggcatttccgggatgggttggagaaggaacccaatggccttacttctttccaaatgtt
actgctgactatgttgttacatggatctacggagcaaagcagcatcataaccttgaaatt
gattatattgggatatggaatgaaaaaaaatatgatccagtatacatcaaggtgctgaga
gatactttggacagagttggttatacaaatgtcggcatcattgctgcagacggagactgg
tccattgcagctgccatgctggaggatccatatctgaatgatgctgttgaggtgataggt
gtccactacccaggcaccaaaacagtgaaggaagctctgttaacagagaagaagctttgg
tcctctgaagattacagcaccttcgatgatgacatcggtgccggatgctgggctcgtatc
ttaaaccagaactacgtgaacggcagaatgacctcgactatatcctggaatttgatagca
agttactatgagaatctgtcctttggtggagatgggctgatgacagctgatgagccctgg
agtggacattatgtagtggaatctccaatatggatgactgcacacactactcaatttaca
cagccaggctggttttatctgcagactgtagggaatctcacccatggaggaagttatgtg
gctttaacggaccgtaaagggaacctcacagttgttattcaaaccatgacacacaatcac
tctcaatgcattcgacctcctctaccgcactttgacgtctcccctcagatagccacattt
cagctcaaaggttcttttgcacatctcactgaccttcaagtgtggtactcaaaattggat
tttgagaccaaaaaagatacactgtttcagcggagcagtcctattaaggtctataatggt
tcattcactttaaaactagatgtcgatgaggtttacacaatcacaacagtcaacactgga
caaaaaggcacctacccagagtcccccaattcccggccatttccaaagaattactctgat
gacttcactatcgataaccctccattctctgaggccccatactttgctgatcaaaccggt
gtgtttgagtacttcagaaatagcacagataatggttcgcatgcctttaccttacggcag
gtggtcaccgaacggccggtcacctgggctagagatgccgaccagaccatcagcatcata
ggggactacagctggacagacctcaatgtgtcctgtgacgtcctaattgaaactcccgtc
actggaggcgtgttcctggcggcccggattgatcaaggtggagagtccgtcagagaagca
aagggtgtcttttattggatttatgcaaatggaacctataaagtgacaaatgatataggt
ggacagagagttcttgcagaagggctgtcaggaacaagggaaggtgtatggtatacctta
acccttagaatcaagggatattttgccaccgggatgctgaatggctatccgctgtggaag
aacgctgttgttcttgaacccaagaatggctggactgcactaggaactctctcttttgaa
tatgcacagtttgataattttgaagtgaatgcagaataa

DBGET integrated database retrieval system