KEGG   Sinocyclocheilus anshuiensis: 107680696Help
Entry
107680696         CDS       T04917                                 

Definition
(RefSeq) isotocin receptor-like
  KO
K04229  oxytocin receptor
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04020  Calcium signaling pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107680696
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107680696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107680696
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Peptide
   Oxytocin
    107680696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Gaa1
Motif
Other DBs
NCBI-GeneID: 107680696
NCBI-ProteinID: XP_016332191
Position
Unknown
AA seq 385 aa AA seqDB search
MESLLKETIFWPFNDSWANSSKGNGSSGLNQTVNPLKRNEEVAKVEVTVLGLILLLALAG
NLCVLVAIQASKHVQSRMYYFMKHLCFADLVVAVFQVLPQLIWDITFRFYGPDILCRLVK
YLQVVGMFASTFMLVLMSIDRCLAIWQPLRSLRRRKDRFFVLASWIISLLFSLPQVYIFS
LREVGDGVFDCWGDFVQPWGAKAYVTWISLTIYIIPVAILSVCYGFISYKIWQNFKLKTR
RDQCLSLTPRPAKGTALSRVSSVKLISKAKIRTVKMTFVIVLAYIICWTPFFFVQMWSAW
DPMAPREASDTMAFIIAMLLASLNSCCNPWIYMFFAGHLFQDLMQRCLMASHCGCKRQWR
SKSPSGMGAMRNTSSQKSVTQSSTT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgctgaaagaaacgatcttctggcccttcaacgactcctgggccaattca
agcaagggaaacggcagcagtggattgaaccaaaccgtaaatcctctgaagcgcaacgaa
gaagtggctaaagtcgaagtaaccgtcctcgggttgattctgctgctggcgctcgccggc
aacctgtgcgtccttgtggctatccaggcgagtaaacacgttcagtcgcggatgtactat
tttatgaaacacctgtgcttcgctgacctggtggtggcggtttttcaagttctcccccaa
cttatttgggacatcacctttcgtttttatggaccagacattctgtgccgcctggtgaag
tacctacaggtggttggcatgttcgcgtccactttcatgctcgtgttgatgtctatcgac
agatgtttggctatatggcagcctctgcgatccctgcgccgtcgaaaggaccgttttttc
gtactggcctcttggattataagcctgctcttcagtttgccacaggtttacatcttctcc
ctcagagaggtgggcgacggggtgttcgactgctggggggattttgttcagccctggggc
gcaaaggcttacgttacatggattagtctcacaatctatatcattcctgtagccatttta
agcgtttgttatggatttataagctataaaatatggcaaaactttaagcttaagacccgg
cgcgaccagtgcctgtcgttgaccccgcggccagctaagggcaccgcgctctcccgcgtc
agcagcgtaaagttgatctccaaagctaagatcaggacggtgaaaatgacgtttgtgatc
gtcctggcctatatcatctgctggacgccgttttttttcgttcagatgtggtccgcctgg
gatccaatggctccaagagaagcgtctgacactatggcgttcattattgcgatgcttctg
gcaagtctcaacagctgctgtaacccctggatctacatgtttttcgctggtcatctgttc
caggatctcatgcagcgctgtcttatggcatcacactgcggctgtaagaggcaatggaga
tctaagagcccttcaggcatgggtgcaatgaggaacaccagcagccagaagagtgtgacg
cagtcctctactacatga

DBGET integrated database retrieval system