KEGG   Sinocyclocheilus anshuiensis: 107681164Help
Entry
107681164         CDS       T04917                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00020  Citrate cycle (TCA cycle)
sanh00620  Pyruvate metabolism
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107681164
   00020 Citrate cycle (TCA cycle)
    107681164
   00620 Pyruvate metabolism
    107681164
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107681164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 107681164
NCBI-ProteinID: XP_016332845
Position
Unknown
AA seq 644 aa AA seqDB search
MLRLALRVRPSSRLTRPSVLSGPAAASPRSGPLSCHHLKRYHSSGPARTRILCHGRCVFN
SILSKRSWVLRSQTASSSQSMRMYSLPPHQKVELPALSPTMQMGTIARWEKKEGDKINEG
DLIAEVETDKATVGFEMLEECYLAKILVPQGTRDVAIGAVICITVDNPDLIPAFKDLTLD
KIASSAPAAAPPPPAAPAAAPASPQVPGSSFPPHMKILLPALSPTMTMGTVQRWEKKVGE
KLGEGDLLAEIETDKATIGFEVQEEGYLAKILIAEGTRDVPLGTPLCIIVEKESDISTFA
DYVETGVATSPPPAPTPVATPPPAPAPAAPTPAPAAAPRKGRVFASPLAKKLAAEKGIDI
AQVTGTGPDGRLTRKDIDSFVPPKPTPTPAAAPTPAAPTPSPPATPAFAAVPTGTFTDIP
ISNIRRVIAQRLMQSKQTIPHYYLSIDVNMDQVLELRKELNAEVKADNIKLSVNDFIIKA
SALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPVGLITPIVFNAHIKGLATISKDVAT
LAAKAREGKLQPHEFQGGTFTISNLGMYGIKHFSAIINPPQACILAVGGSEKRLLPADNE
KGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKFLEKPFTMLL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtttagcgctgcgagtgcgtccatcatccaggctcacccggcccagtgtcctg
tcgggccctgctgctgctagtccacgatccggaccgctatcatgccatcatctcaagcga
taccactccagcggcccggcccggacccggatcttgtgtcacggtcggtgtgtgttcaac
agcatcctcagtaagagatcatgggtcttgcgaagccagacggctagttccagtcaaagc
atgcgaatgtacagtctgccaccacatcagaaggtggaactacccgctttgtcccccact
atgcagatgggcactattgcacgctgggagaaaaaagaaggagacaaaatcaatgaggga
gatttgatcgctgaggttgaaacagacaaggctacggttggatttgaaatgctggaggag
tgttaccttgccaagatcttggtccctcagggtacaagagatgtggccattggagctgtc
atttgcattacagttgacaatcctgacctcatccctgcatttaaggaccttacattggat
aaaatcgctagctccgcccctgcagctgcccctccccctccagcagcgcctgctgctgct
cctgcttcaccacaagttcctggaagctccttcccacctcacatgaaaattcttctccca
gctctctcccccaccatgactatgggcaccgtgcagcgctgggagaagaaggtgggtgag
aaactcggtgagggagacctgctggctgaaatcgagacggataaggcaacaatcggtttt
gaggtacaggaggagggttacctggctaagatattgattgctgagggcaccagggacgtt
cctcttggcactcctctctgtatcattgtggaaaaggaatccgacattagcacgttcgct
gactatgtagagacaggggtggctacaagcccacctcctgctcccacaccggtggccacc
ccaccgccagcaccagctccagcagctcccaccccagcacctgccgctgctcctaggaag
ggtagggtgtttgccagtcctctagccaagaaactggctgccgagaagggaattgacatc
gcccaagtcacaggaactggaccagacggcagactcaccaggaaagatatcgacagtttc
gttccacctaagcccactcctacaccagctgctgctcctacccctgctgcacccacaccc
agccctccagccacccctgcttttgctgctgtacctacaggaaccttcactgacatcccc
atcagcaacatccgcagagtgattgcccagaggttgatgcagtcgaagcagactattcct
cactattatttgtctatcgatgtcaacatggaccaggttcttgaactcaggaaagaactc
aatgctgaggtgaaagcggataacatcaaactctcggtcaatgacttcatcatcaaggcc
tcggctctggcctgtttaaaggtgccagaggccaactcctcctggatggacacagtcatc
agacaaaatcacgtggtggatgttagtgtcgcagtcagtacgcctgtgggtctaatcact
cccattgtatttaatgctcatattaagggtcttgcgactatcagcaaagacgtagccaca
ttagctgctaaagcacgagagggaaaactgcaaccgcacgaattccagggtggcaccttc
actatttccaatctgggcatgtatggcatcaagcatttttcagctatcattaaccctcct
caagcctgcattctggctgtgggtggctcagaaaagagactgctgcctgcagacaacgaa
aaagggtttgatgtggcaagcatgatgtctgtgactctgagctgtgatcaccgggtggta
gatggtgctgttggcgcacagtggctggccgagttccgcaagttcctggagaaaccgttc
accatgctcctgtga

DBGET integrated database retrieval system