KEGG   Sinocyclocheilus anshuiensis: 107682463Help
Entry
107682463         CDS       T04917                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00230  Purine metabolism
sanh01100  Metabolic pathways
sanh04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107682463
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107682463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107682463
Enzymes [BR:sanh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107682463
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107682463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA CcmD
Motif
Other DBs
NCBI-GeneID: 107682463
NCBI-ProteinID: XP_016334179
Position
Unknown
AA seq 1107 aa AA seqDB search
MQHLHLPFGGALWELSSYPYCLVLRSRHSLSTLPFYSITLWIILGVLTFPCCVQCLIFKV
GVLGPWNCDPYYAKSLPAIASKLAVGRINEDFSLDLGCTMDFVILQEACETSKALTSFVQ
YENMVDAFVGPTNPGYCNAAVLMGKNWDKSIFSWACINYELDRVQGYPTFARTLPSPTRV
LFSVLKFFSLANIAIVSSNEDIWIDTAAKLASALRNQGLPVGIVVSMGNNDTMLENTLLS
IRNAGEIKVIIMCMHSALIGGEQQTSFLMKAHDMGLTKGQYVFIPYDTLLYSLPYTNTTY
SPLQNNTKLRKAYDAVLTITIESELMSFNEAYNMAKRLGELMVSQEPEQVSPLFGTIYNS
LYLLAKSMHNARRAGKWFSGSNLASFTRNITFSGFNQNIRTDGQGNGQTDYVILDTDGWG
SELYRCFYVNLTLDKVLFAGTYINFPAGSPPPSDSSCWFDPNAICSGGVEIIYVVIAFVI
VLIMVLGSIGLSLFIRRRIQKIQLIKGPNRILLTLEDLTFINPQLSKRKITLEDLCDSKS
YIEEKSTGELSRSVNSMATATHETSNVAVYEGDWVWLKKFKEGDFKEVKQSTTKIFTKMK
DLRNENVNPFLGFFTDCEMFAIVTEHCSRGSLHDLLRNEDVKLDWMFKSSLVLDLIKGMK
YLHHREFPHGHLKSRNCVVDGRFVLKITDYGYNEILETQKAPKETPPLEDLFWTAPEFLR
DPESPRKGTYKGDVYSFAIILQEVVVRGAPYCMLGLSPEEIIRKVKKPPPMCRPTVAPDQ
APLECIQLMKQCWSEQPDRRPPFDQIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLI
RERTEELEVEKQRTEKLLAEMLPPSVAEALKTGASVEPEYFDQVTIYFSDIVGFTTISSL
SDPIDVVDLLNDLYTLFDAVLGSHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLN
ILSSVGTFKMRHMPDVPVRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLP
YRIHVNISTVNILRSLNDGYQIEVRGKTELKGKGIEETYWLVGKSNFTKPLPKPPEIKPG
DNWQDMVMEEIKSLFRKANRQVDKPKI
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcttcacctcccattcggaggtgctttatgggagttatccagttacccctac
tgcctcgttctcaggagcagacacagcctctctacgctcccattttacagcattacacta
tggattattcttggtgtgttgacgtttccatgctgtgtccaatgcctgattttcaaagta
ggtgtcttggggccttggaactgtgacccttattacgcaaaatcacttcctgccattgcg
tccaaactggctgttggccgcataaacgaggattttagtttagatcttggctgcacaatg
gactttgtcatccttcaggaggcctgtgagacatccaaagccttgacctcgtttgtacaa
tatgagaacatggttgatgcatttgtaggccctacaaatccaggatactgcaatgctgcg
gtgctcatgggcaagaattgggacaagtctatattttcatgggcgtgcattaactatgag
ttagaccgggtccagggctacccaacatttgctcgaactttaccatccccgacacgggtg
ctttttagtgtacttaagtttttcagcttggctaacatagccatcgtgtcttctaatgag
gatatatggatcgacacggctgccaaattggctagtgctctcagaaaccaggggcttcct
gttggcatcgttgtgtccatggggaataatgacaccatgctggagaacacgttgctgagc
atacgaaacgcaggggagataaaagtcatcattatgtgcatgcactcagcactcattgga
ggagagcaacaaacttcattcctgatgaaggcccatgacatgggattgacaaagggtcaa
tatgtgtttataccatacgacacccttctgtacagcctgccctacaccaacaccacctac
tccccactgcaaaacaacaccaaactgcgcaaagcctatgacgctgtactcaccatcacc
atagagtcagagctgatgtcattcaacgaagcgtacaatatggccaaacgacttggagaa
ctgatggtgtcacaagagccagagcaggtctctccgctctttggtacaatctacaacagt
ttgtacctccttgccaagtccatgcacaatgccagaagagctggtaagtggttctccggg
tccaacctggcttccttcacgaggaacattacattttccgggttcaaccagaatatccgc
acggatggccaagggaatgggcaaaccgactatgtgatcttagacactgatggctgggga
tctgaactgtatcgctgcttttatgtgaacctgacgttagataaggtgctgtttgccggc
acgtacattaatttccctgcaggttcacctccaccttcagactccagctgctggtttgac
cccaatgccatctgctcaggaggtgtggaaattatatatgttgtcatagcgtttgtgatt
gtcctcattatggttcttggttctattggtctaagtctattcataaggaggcgaatccaa
aaaatccagctgatcaaagggcccaacagaatcctgcttacgcttgaggacctgaccttc
atcaaccctcagctgagcaagagaaaaatcacccttgaagatctttgtgattcaaaaagt
tacattgaggagaagagcacaggtgaactttcccgctctgtgaatagcatggcaacagca
acacatgaaacttcaaacgtggctgtctatgagggcgactgggtgtggctaaaaaagttt
aaggagggagacttcaaagaggttaaacagagcaccactaagatcttcaccaagatgaag
gacctacggaatgaaaatgtcaatccgtttttggggttcttcaccgattgtgagatgttt
gccattgtgactgaacactgttcacgggggagtctacatgacctcctccgtaatgaagat
gtcaaactggactggatgtttaaatcctccttagtgctggatctcatcaagggcatgaaa
tatcttcaccacagggaatttcctcatgggcacctgaagtctcgtaattgtgtagtagat
ggccgttttgtcttaaagatcactgattatggttacaatgagattcttgagacccagaaa
gctccaaaggagaccccacctctagaggatctattctggacagctcctgaatttctcaga
gaccctgaaagtccacggaaaggaacttataaaggagatgtgtacagttttgcaattata
cttcaagaagtagtggtcagaggagcgccatactgcatgctcggcttgtctcctgaagag
ataataaggaaggtgaagaaacctccgcctatgtgcaggcccactgtagctccagatcaa
gctccactggaatgcatccagttaatgaagcagtgctggagtgaacaacctgatagaagg
cctccttttgatcagatctttgatcagttcaagctcattaacaagggcaaaaagaccaat
attattgactccatgttgcgtatgctggagcagtactcctctaacctggaggaccttatc
agggaaagaacggaagagctggaggtagagaaacagaggacggagaagcttctggctgag
atgcttcctccttctgtggcagaagctctgaaaaccggtgcctccgtggagccagagtac
tttgatcaagtcaccatctacttcagtgacattgtaggcttcaccaccatctcatccctt
agtgatccaattgacgttgtggacctgctcaatgacctttacaccttatttgatgccgtg
ctgggcagccatgatgtctacaaggttgaaaccattggagatgcctacatggtggcctcc
gggctgccgaagaggaacggcaacaagcacgcagccgaaatcgccaacatgtccctgaac
attctcagctccgtgggcaccttcaagatgcggcacatgccagacgttccggtcaggata
cggatcggcattcattcagggtcgtgtgttgctggagttgtgggtctaactatgcctaga
tactgcctttttggagacacagtcaacaccgcctctcgtatggaatctacagggttgcct
tacagaattcatgtgaacattagtacagtgaatattctccgctcattgaacgatggctac
caaatagaagttcgaggaaagactgagctaaaggggaaaggcattgaggaaacatactgg
cttgttgggaaatctaattttactaagcctttgccaaaaccaccagagatcaaaccagga
gataactggcaagacatggtgatggaggagatcaagtcattatttcgcaaggccaacaga
caagtggacaagcccaaaatctga

DBGET integrated database retrieval system