KEGG   Sinocyclocheilus anshuiensis: 107686836Help
Entry
107686836         CDS       T04917                                 

Gene name
enosf1
Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00051  Fructose and mannose metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107686836 (enosf1)
Enzymes [BR:sanh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     107686836 (enosf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 107686836
NCBI-ProteinID: XP_016339478
Position
Unknown
AA seq 443 aa AA seqDB search
MLERKITHLTVRDVRFPTSLEQHGSDAMHTDPDYSVAYVVLETDSDAALKGYGLTFTVGR
GTEIVVCAVKALSTLVVGKTLKEIISDFRGFYRLLSSDGQMRWVGPEKGVIQLATAAILN
AVWDLWARVEGKPLWKLLVDMDPAKLISCIDFRYITDALTEQEALDILVKAKKGQKSREE
QMLKEGYPAYTTSCAWLGYTDQQLTKLCSEALAQGWNKFKVKVGADLQDDIRRCSLIRKL
IGPNNTLMIDANQRWDVNEAITWVTKLAEFHPLWIEEPTCPDDVLGHASISKALAPLGIG
VATGEQCHNRVMFKQFLQASALQFVQIDSCRVGSVNENLAIILMAAKFNVPVCPHAGGVG
LCELVQHLILFDYVSVSASLNNRMCEYVDHLHEHFKSPTIIRNAHYIPPKDPGYSCEMLE
ESVQKHQYPQGEVWRAIEQQGKQ
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctggaacgcaaaataacacatttgacagtgcgcgacgtaagattcccgacgtcactg
gaacaacacggatcggatgcaatgcacaccgatccagattactcagtcgcatatgttgtt
ctcgagacggactcggatgctgcactgaagggttatgggttgacttttactgtaggaaga
gggacggaaatcgtggtatgtgcagttaaagccttatctactttggtggtcgggaagact
ttgaaggagataatcagtgacttcagaggcttctacagactcctgagcagtgatggtcag
atgagatgggttggaccagaaaaaggagtaattcagctggcgacagcagccattctgaat
gctgtctgggatttatgggcgcgggtggagggcaagcccttgtggaagctacttgtagac
atggatcctgcaaagttgatcagctgtattgattttagatatatcaccgatgcactgact
gagcaggaagctttagatatattggtaaaagcaaaaaaaggtcagaaaagtagagaggag
cagatgttaaaggaaggctatcctgcctacaccacttcctgtgcctggctgggatacact
gaccaacaactaaccaagctctgctctgaagctcttgctcaaggctggaataaatttaaa
gtgaaggttggggctgatttgcaggatgacatccgtagatgcagccttatccggaagttg
attggaccaaacaacaccctgatgattgatgccaaccaacgatgggatgttaatgaagcg
attacttgggtaaccaagctggcagaatttcacccactatggattgaggaacccacatgt
cctgatgatgttttaggtcatgcttccatctctaaggcacttgcacctttgggtattgga
gtcgccactggagagcagtgccataacagagtgatgtttaagcagtttctccaggcctca
gctttacagtttgttcagattgacagttgtagggtgggcagtgtgaatgaaaaccttgcc
atcatacttatggctgccaagtttaatgttcccgtgtgtcctcatgccgggggtgtggga
ctgtgtgagcttgttcagcaccttattttatttgactacgtttcagtgtctgctagttta
aataataggatgtgtgagtatgtagatcaccttcatgaacatttcaaaagccccaccatc
atcagaaatgcccactacataccaccaaaggaccctggatactcctgtgaaatgctggaa
gagtctgtgcaaaagcatcagtatcctcagggtgaggtttggagagccatagagcagcag
gggaaacaataa

DBGET integrated database retrieval system