KEGG   Sinocyclocheilus anshuiensis: 107686975Help
Entry
107686975         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107686975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107686975
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107686975
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: STE group
  STE20 family
   107686975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 107686975
NCBI-ProteinID: XP_016339583
Position
Unknown
AA seq 1109 aa AA seqDB search
MAHESPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEEWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYTQRPPTDQLLKHPFIRDQPNERQVRI
QLKDHLDRCRKKRGEKDETEYEYSGSEEEEEEAQEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKRRADREQEYIRRQLEEEQRHLE
ILQQQLLHEQAMLLVDERHRRSVQGSPQAAVMQKQPPAVPPRSEPFSNGSSSAAEPSHRP
ADPQDLTALAKELRAVEDVRPQHKATDYSSSSDDSGTTDDEDDEEVDQDVGEESTSGPED
SRGGSSRLSNGEMVAAKTMVVQDDDASSTPCKDSTLVMRQFQRSRPVTVLGSGWKDAPSP
SPVEIGQRNCIRGRNPLLPDLLQQSQRSPPSSSSPSSPALSPLSPSDRVPCLAETPTVPK
HKSSSSFTPFIDPRLLQVSPSTGSALNNAGYSNDARLQEALRQDASRKGSVVNVNPVNTR
PQNDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQM
DVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYNVVK
YERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGS
CSGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRI
TKDVVLQWGEMPTSIAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERN
DKVFFASVRSGGSSQVYFMTLGRTSLLSW
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgagtcccccgctaagagcctggtggacatagacctcgcgtcgctgcgcgac
cctgctggcatttttgagctggtggaagtggtcggcaatggcacctacggacaagtgtac
aagggtcgacatgtcaaaaccggacagttggcagccatcaaagtcatggacgtgactgaa
gatgaagaagaggagattaagctggagattaacatgctgaagaaatactctcatcacaga
aacatcgccacgtattacggcgccttcatcaagaagagtcctccaggacacgacgaccag
ctgtggctggtgatggagttttgtggagctggttcgatcacagacctggtgaagaacact
aaagggaataccctgaaggaagaatggattgcgtacatctccagagaaatcctcaggggt
ttggcccacttacacgctcatcacgtcatccacagagacattaagggccaaaatgtgctt
ctgactgaaaacgcagaggtcaagttagtggacttcggcgtcagcgctcagctggatcga
accgtgggccgcaggaacaccttcatcgggacgccgtactggatggctcccgaggtcatt
gcctgcgacgagaacccagacgccacgtacgactacaggagcgatctgtggtcctgtggg
atcacggcgatagagatggccgagggcgctcctccgttgtgcgatatgcatcccatgcga
gcgctctttctcatacccagaaatcctccgcccagactcaagtccaagaaatggtctaag
aagttcttcagcttcatcgagggctgtctggtgaagaactacacgcagcggccgcccacc
gatcagctgctgaagcaccccttcatcagagaccagcccaacgagcggcaggtgcgcatc
cagctcaaagaccacctggaccgctgccgcaagaagcgcggagagaaagacgagaccgag
tacgagtacagcggcagtgaggaagaggaggaggaggctcaggagcaggagggagagccc
agctctatcgtgaacgtgccgggtgagtcgactctgcggcgggacttcatccgtctgcag
caggagaataaggagcgctcggaggccctgagacgccagcagctcctccaggagcagcag
ctccgcgagcaggaggagtacaagcggcagctgctggccgagcgacagaagcgcatcgag
cagcagaaggagcagaggaggcgtctggaggagcaacagagacgcgagcgcgagatgagg
aggcagcaggagcgagagcagaggaggagagagcaggaggagaagagacgcctggaggag
atggagaggaggcgcaaagaggaggaggagcgccgaagggcagaggaggagaagaggagg
gctgaccgcgagcaggagtacatccgccggcagctggaggaggagcagaggcacctggag
atcctgcagcagcagctgctacacgagcaggccatgctactggtggatgagcgtcaccgg
aggagcgtgcagggctctcctcaggccgccgtcatgcagaagcagccccccgctgtgccg
ccgcgctcagagcccttctccaacggcagcagcagcgcggccgaacccagccaccggccc
gccgacccgcaggatttgacggccctcgctaaagagctgcgtgccgtggaggacgtgcgt
ccgcagcacaaagccaccgactactcctcctccagcgatgactctgggaccactgacgat
gaagacgacgaggaggtggatcaggacgtgggagaggagtcgacgtccggcccggaggac
tcccgcggaggctcgtccagactcagtaatggtgagatggtagcagcgaagacgatggtt
gtccaagacgacgacgcctcctctacgccgtgcaaagacagcacgctggtcatgcgacag
ttccagagatcacggcctgtgacagtgttgggttcaggctggaaagacgctcctagtccc
agtcctgtagagattgggcagaggaactgcattaggggtcgaaatcccctgctgcccgac
ctgctccagcagagtcagcgctctcccccctcttcctcctctcccagcagccctgccctg
tcccccctcagtccctcggacagagtcccgtgcctagcagagactcccaccgtgccgaag
cacaagtcttcctcgtctttcacacccttcattgacccgcgtctcctccaggtctctcca
tccaccggcagcgcgctcaataatgctggttacagtaatgacgctcgactgcaggaggct
ctgcggcaggacgcgtctcgtaagggatcggtggtcaacgtcaatcctgtcaacacacgg
ccacagaatgacacgccagagatccgcaagtacaagaagaggttcaattcagagatcctg
tgcgctgctctctggggtgtgaatctgttggttgggacagagagcggcctcatgctgctg
gatcgcagcggtcaggggaaagtctacccgctcataagccgcagacgcttccagcagatg
gatgttctggagggactcaatgtgctcgtgacgatatcagggaagaagaataaattgcgg
gtgtactatctgtcctggctgaggaacaagatcctccataatgaccctgaggtggagaag
aagcagggctggaccaccgtaggagatctagagggctgtgtgcactacaacgttgtgaag
tacgagaggatcaagttcttggttctggccctgaagaattcagtagaggtgtacgcgtgg
gctcccaaaccgtaccataaattcatggctttcaagtcgttcggtgatctggtgcacaag
ccgctgctggttgacctcacagttgaagaaggccaaaggttaaaggtcatctatgggtcc
tgctctggctttcatgctgtggatgtggactcaggagccgtctatgacatttatctgcca
actcacattcagaccagtattcagtcgcatgccatcatcatcctgccaaacacggatggc
attgagctgctggtgtgttatgaagacgagggcgtgtatgtcaacacctacggccgcatc
accaaagacgtggtgctccagtggggcgagatgcccacctccatcgcttatatccgctct
aaccagatcatgggctggggagagaaggccatagagatccgctcggtggaaacaggccac
ctggatggagttttcatgcacaaaagagcacaaaggctcaagtttctgtgtgagagaaat
gacaaggtcttctttgcgtctgtgcgttctggaggctcgagtcaggtgtacttcatgacg
ctgggccgcacctccctgctcagctggtaa

DBGET integrated database retrieval system