KEGG   Sinocyclocheilus anshuiensis: 107689612Help
Entry
107689612         CDS       T04917                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like isoform X1
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04260  Cardiac muscle contraction
sanh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107689612
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107689612
   04261 Adrenergic signaling in cardiomyocytes
    107689612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sanh04040]
    107689612
Ion channels [BR:sanh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107689612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107689612
NCBI-ProteinID: XP_016343149
Position
Unknown
AA seq 309 aa AA seqDB search
MLMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSNNENETSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDAAEYLLRAVRASSIFPIMSVGLLFMGGL
CVAAGEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWSFY
FGALSFIMAEMVGVLAVHMFIEKHRKLRTKSRTELIKKSAFSRIPSYRYRFRRRSSCRSS
EPASRDASPMGKSGYTGPAAADISMYTLSRDPSKAAMGALLNSEREFLQAHNSNAKDFKD
AANRRTTPV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgtgtgacagaggagtccaaatgctcatcaccacagtgggcgcgttcgccgcg
ttcagcctgatgactatcgctgtgggaacggactactggctgtactcacgaggagtgtgc
cgggtcaaaagtaataacgagaacgagacgagcaggaagaatgaggaagtcatgacccac
tccggactgtggagaacctgctgtctagaaggaacatttcgaggtgtctgtaagaagatt
gaccactttccggaggatgcagattatgagcaggatgcagcagagtatttactacgagca
gtgagagcgtccagcatcttccccatcatgagcgttgggcttctgttcatgggaggtttg
tgtgtggctgccggtgagttttacaggagcagacacaatgtcatcctcagtgctggaatc
ttctttgtctctgctggcctaagtaacatcatcggtattatcgtgtacatatccgccaat
tcgggtgaccctggccagagcgattcaaagaagagctactcatacggctggtccttctac
ttcggcgcactgtccttcataatggccgagatggtgggcgtgcttgccgtgcacatgttc
atcgagaaacaccggaagctgcgcaccaagtcccgcaccgagctgatcaagaagtcggcc
ttcagtcgcatccccagctaccgctaccgattccgccggcgctccagctgccgctccagt
gagcctgcctcgcgtgacgcttcgcccatgggcaagagcgggtacacgggccccgctgcg
gcagacatctccatgtacaccctgtccagggatccctccaaggcggcaatgggtgccttg
ctcaactccgagagggagtttttgcaggctcacaactccaacgctaaggacttcaaagat
gcggccaacaggaggaccactccagtctga

DBGET integrated database retrieval system