KEGG   Sinocyclocheilus anshuiensis: 107690289Help
Entry
107690289         CDS       T04917                                 

Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase-like
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107690289
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     107690289
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   107690289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase
Motif
Other DBs
NCBI-GeneID: 107690289
NCBI-ProteinID: XP_016344067
Position
Unknown
AA seq 429 aa AA seqDB search
MDAEQNQEVPEAVAETQEVAMKQEEKSEPKSKEVAPSEPAEPPKAAPEPEKTPEMEHSAG
GLPEKEKATDSKAPPAKPSEPEVALEKSPEETPAAESSEKPPEPEQQKKSEEPQVQVNSE
PEKQEEEAVKEVEPKKEAESKPTAVNEAKPEESDKGEETKTEGGEDKVQPEADGVQAEPP
KEAETKQKEPELPLFFGWFLLPEEEERIKCATMDFLKTLDTLEAFKEHISEFTGEVEKEV
DLEQYFQNPLQLHCTTKFCDYGKAEGAKEYAELQVVKESLAKSYELSVTALIVTPRTFGA
RVALTETQLKLWPEGADKEGVAPALLPSVEALPAGSRAHVTLGCSAGIEGVQTGLDLLEI
LALQKEGKEGTQVEMDLGTLTYLSEGRWFLALREPITADTTFTSFSDDKPTNDQGKKDGE
KKKKKCTIL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgaacagaatcaggaagttccagaggctgttgctgagacacaggaagtggcg
atgaaacaagaggagaaatcggagcctaagtccaaagaggtggcaccttcagaacccgca
gaacctccaaaagcagcccctgaacccgagaagaccccagagatggagcattctgctggg
ggattgccagaaaaggagaaagcgacggactctaaagcgcctcctgccaaaccgtctgaa
cccgaggtggcgctggaaaaatctcctgaggaaaccccggctgccgagtcttctgagaaa
ccccctgagccagaacagcagaagaagtctgaggagccacaggttcaagtgaattctgag
cctgagaagcaggaggaagaagctgtgaaagaggtggagcctaagaaagaggccgagtcc
aaacccactgctgtgaatgaagccaagcccgaagaatctgataaaggtgaggagaccaag
acagaaggaggagaggataaggtacaaccagaggctgatggagttcaagctgagcctccg
aaagaggcagagaccaagcagaaagagccagagctgcctttgttctttggctggttcctg
cttccagaggaagaggagcgaattaagtgtgcaaccatggactttctcaagacgctggac
actttggaggccttcaaagaacacatcagtgaatttactggtgaggtggagaaagaagtg
gatcttgagcagtatttccagaacccattgcaactccactgcactacaaagttctgtgat
tatggaaaagcagagggggctaaagagtatgcagagctacaggtggtcaaggaatctctt
gccaaatcttatgagctttccgtcactgctctcatagtgacccctcgtacgtttggggcc
cgtgtggctttgacggaaacccagttgaagctgtggcccgagggagcagacaaagaaggg
gtcgctccggccctcctgcccagtgtagaggctcttccagcgggtagccgtgcccacgtc
acattaggctgctcggcaggcattgagggggttcagaccggtttggatttgctggagatc
ctggctctgcagaaggagggcaaggagggcacccaggtcgagatggacttgggtactttg
acctacctgagcgagggccgctggttcctcgccctgagggaaccgattaccgcagatacc
accttcactagcttctctgacgacaagcccaccaatgaccagggcaaaaaggatggagag
aagaaaaagaaaaagtgtaccattctgtga

DBGET integrated database retrieval system