KEGG   Sinocyclocheilus anshuiensis: 107690669Help
Entry
107690669         CDS       T04917                                 

Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2-like
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00230  Purine metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107690669
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     107690669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 VMA21
Motif
Other DBs
NCBI-GeneID: 107690669
NCBI-ProteinID: XP_016344542
Position
Unknown
AA seq 502 aa AA seqDB search
MVSMGNQQQCQIITATAALFLAVCGILLLVVPTEDVKEPPEFMYGIVLDAGSSHTAMFIY
KWPADKQNGTGIVSQHSECHAKGGGISSHAGNRGGAARSLEECMEQAMQEIPKSRHKLTP
LYLGATAGMRLLNISKPKDSDEVLKEVGDKLKTYPFSFKGATILSGQEEGAYGWVTVNYL
LENYIKYGFVGQWLSPGRDTVGALDFGGASTQITFETKQTVENKDNLMKLRLYGRDYQIY
TKSFLCYGRDQVLLRLLALLMKTQGSDRSIVHPCYPAGHSDSIKLSSVFDTPCDKRQTPY
KPDDDLQIKGTGNYDQCLGNVSHLFSFNKCSYSKCSFDEVFQPNITGNFMAFSAFFYTHS
FLQEASGISIMSPEHLEDATRVVCNMSFQEMTNKVQGQRSRLKDYCAVSAFVQVLLVNGY
GFDYLSFPHISFQKKAGDTSVGWSLGYMLSLSNLLPAEDVLQRKSLCSSIWSALIALFCV
LLIMALYFLLRAIRKKDTDNAI
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtatccatgggtaaccaacagcagtgccagatcattaccgctacagcggctctgttt
ctggcagtctgcggcattcttctgctcgtcgtacccaccgaagacgtcaaagagccgcca
gagtttatgtatggaatagtcctggatgctggatcctctcatacggccatgttcatctac
aaatggccagcagacaagcagaacggtaccggcatagtcagtcaacacagcgagtgtcat
gccaagggaggcgggatctccagtcatgcaggtaacagaggaggagcagctcgtagtctt
gaggaatgcatggaacaagccatgcaagagatcccaaagtcaagacacaaactcacccct
ttgtatcttggggcaacggcaggcatgagactactgaatatttctaaacccaaagattca
gatgaggttttgaaggaagtgggagacaaactgaagacctacccatttagcttcaaaggg
gccactatcttaagtggacaagaagagggggcttatggatgggtcacagtcaactacctg
cttgagaattacatcaagtatggttttgtgggtcagtggctgtctccaggcagagacacg
gttggtgctctggactttggtggagcttcaactcagatcacctttgaaacaaaacagacg
gtggagaacaaggacaatctgatgaaactgcggctgtacggacgagactatcagatttac
actaagagctttctgtgttatgggagagaccaggtgttactcagactgctggcacttctg
atgaagactcagggttcagaccgctccatagttcacccctgctatcctgcgggtcacagt
gactccataaagctgagcagtgtgtttgatactccatgcgataaaagacaaactccctat
aaacctgatgatgacctgcaaatcaaaggcacgggaaactacgatcaatgccttggaaat
gtttctcatctcttttcttttaacaaatgttcttattccaaatgctcctttgatgaagtc
ttccagcccaacattactggaaactttatggcattttctgcatttttctacacccattcc
tttcttcaggaagcatcaggcatcagcatcatgtccccagaacatttagaggacgctacc
cgtgttgtctgcaacatgagctttcaggagatgacaaataaggttcagggtcagcgaagc
cgtcttaaggactactgcgcagtctctgcctttgtgcaggtgctactggtcaatggatat
ggctttgattacctctccttcccgcacatctccttccagaagaaggcaggagacacgtct
gtcggctggtcccttggctacatgctaagccttagcaacctgctgcctgctgaagatgtt
ttacagaggaaatcgctgtgctcaagtatctggagtgctctgatcgccctcttttgcgtc
cttcttattatggcgctatattttttgttgcgagccattcgtaagaaagacactgataat
gccatttaa

DBGET integrated database retrieval system