KEGG   Sinocyclocheilus anshuiensis: 107691499Help
Entry
107691499         CDS       T04917                                 

Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase-like
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sanh03016]
    107691499
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     107691499
Transfer RNA biogenesis [BR:sanh03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    107691499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 107691499
NCBI-ProteinID: XP_016345600
Position
Unknown
AA seq 832 aa AA seqDB search
MKRKSGNNADTTEGVFQSNVRLCHERVSSAGAEKCSSSGRCSVRTQRRFISRVICVSNMG
RKNRNRQRAQQNRDGRAEGKRSRDDAGWGAGYAEIIKENKLFEHYYTELKIVPEGEFEEF
MEAMREPLPATIRITGYKSHAKEILHTLKEKYFKEVQDLEVDGQKIEAPQPLSWYPDELA
WHTNLSRKILRKSPLLEKFHQFLVSETESGNISRQEAVSMIPPLLLKIEPQHKILDMCAA
PGSKTAQLIEMVHSDMDVPFPEGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDASSI
PRLYFDQDGKKDILFYDRILCDVPCSGDGTMRKNIDVWKKWTTSNSLQLHGLQIRIAVRG
VEQLAVGGRMVYSTCSLNPIEDEAVIAALLEKSEGALELADASPDLPGLKYMPGITSWKV
MTKEGQWYSDWSEVPTSRHTQIRPTMFPPTDPEKLANMKLERCMRILPHHQNTGGFFVAV
LVKKAPMPWNRRYPKLRYKDVTSSSEAAPAEELQMGESPTDVPPADGSSADAPVEAVEGE
TPAEGNPSVPDTPDLLEVKKDNVCGPPPPKKMKLFGFKEDPFVFLTEDDPIFPSIQAFYD
LSPDFPKLNVLTRTHEGKKRQLYMVSKELRNVLLNNSERMKVINTGVKVWSRNTDGEQFG
CAFRLAQEGIYTLCPYIRARIINICVEDVKVLLTQENPFLRKLGDDAHNQAKKLGMGSIV
LRYLPDPKDLDAPQCPIDLCGWRGKTSIRAFVPRNERLHYLRMVGVEVFHDKQGKRNDCS
TEIQEGSTEDAVGLSQEADLLEEEGEETEQNGSESNANGTEPVGSTCDGPAS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaagtcaggcaataatgcggacaccacggaaggggtctttcagtcgaatgtg
cgcttgtgtcacgaacgcgtgagttcagcaggagcggagaagtgcagttcttcaggcagg
tgctcagtcagaacgcaacgcaggtttatatccagagttatatgcgtgtccaacatgggc
aggaaaaacagaaacagacaaagagctcagcagaacagagatggaagagctgaggggaaa
agaagcagagatgacgctggctggggagctggatacgcagagatcatcaaggaaaacaaa
ctctttgagcattactacacggagctgaagattgttcccgagggagagtttgaggagttc
atggaggccatgagggagccactgccagctacaatacggatcactggatacaagagtcat
gccaaagaaatccttcatactcttaaagagaaatacttcaaagaggttcaagatcttgag
gtggatgggcagaagattgaggctcctcagcccttaagttggtatcctgatgaactggcg
tggcacactaatctgagcagaaagattctgcgcaaatctccactcctggagaaattccac
cagttcttggtcagcgaaacggaatcgggaaatattagcagacaggaagcagtcagtatg
attcctcctcttctactgaaaattgagcctcaacataagattctggacatgtgtgcagct
ccaggatcaaagactgctcaactaatcgagatggttcactctgacatggacgtgcctttc
cctgagggttttgtaattgccaatgatgtggataacaagcgctgttacctgctggtccac
caggccaagagattgaacagtccgtgtattatggtggtcaaccatgacgcctctagcatt
ccacgtctgtactttgatcaggacgggaagaaggacatcctgttttatgaccggatcctg
tgtgatgtaccctgcagtggagatggaacaatgaggaaaaacattgatgtgtggaaaaaa
tggacaaccagcaacagcctgcagctccacgggctgcagatcaggatcgcagtacgaggt
gtggagcagctggcagtagggggcaggatggtgtactccacctgctctctgaaccccatc
gaggatgaagccgtcatcgctgctctgctggagaagagtgaaggtgctttagagttagct
gatgcctctccagatctcccaggactcaaatatatgcctggaattacatcttggaaggta
atgaccaaagagggtcagtggtactctgactggtcagaggtgccgacaagtcgacacact
caaatcagacccaccatgtttccaccaacagacccagagaagctggccaatatgaagctg
gagagatgtatgagaatattgccccatcaccagaacactggcgggttttttgtggctgtg
ttggtgaagaaggcacccatgccatggaaccgccgttacccaaagcttcgttataaggat
gtgacctcctccagtgaggcggctcctgcagaggagctgcagatgggggagtctcccact
gacgtcccaccagcagacggctcgtccgctgatgcccctgtggaagcagtggagggcgag
actcctgcagagggaaacccgtctgtcccggatactcctgaccttttagaggtcaagaaa
gataatgtctgtggcccccctcctccaaagaagatgaaactctttggtttcaaagaggat
ccttttgtgtttctgacagaggatgaccctatcttcccttccatccaagctttctacgac
ctgtctccagatttccccaagcttaacgtattgactcgaacccatgaaggaaagaagagg
caactgtatatggtatccaaagagctccgcaatgttctgctcaacaacagtgagagaatg
aaggttataaacacaggcgtgaaggtctggtccagaaatactgatggagaacagtttggt
tgtgctttcagactggctcaggagggtatttacacgctgtgtccctacatcagagcccga
atcatcaacatctgtgtggaggacgtgaaggtgctcctcacgcaggagaaccccttcctc
aggaaacttggagatgatgctcacaatcaggccaagaaacttggaatgggcagcattgtt
ttaagatacctaccagatccgaaggatcttgatgctcctcagtgccctatagatttgtgc
ggctggagggggaaaacttccatcagggctttcgtcccacgtaatgagcgtcttcattac
ctccgtatggtgggggtggaagtcttccatgacaaacagggcaagaggaatgactgttca
accgaaatccaggaaggaagcacagaagatgccgtgggactgagccaagaggcagatctc
ttagaagaggaaggtgaagaaacggagcaaaatggttcagagtccaacgctaatggcaca
gaacctgttggtagcacttgtgatgggcctgcgagttag

DBGET integrated database retrieval system