KEGG   Sinocyclocheilus anshuiensis: 107691575
Entry
107691575         CDS       T04917                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107691575 (adamts13)
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107691575 (adamts13)
Peptidases and inhibitors [BR:sanh01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107691575 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 TSP1_CCN Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 107691575
NCBI-ProteinID: XP_016345719
UniProt: A0A671MNX0
Position
Unknown
AA seq 1549 aa
MWTNMGALIWLFLAPSLLKTTALLISQCTLQKDFLESLKPQDLFYYFDTISIKSVPHFEL
VWVNCSRNESFRGLWRCSFHSEEESFELGQHRDEQPVSCPTSLEMVINSTVSVVKKREDM
CCEQLKLLRPAHTRTLLPICHGKLQGLIQSGEKRLCIRPVLQKHIDHLKELTVDLPSGVP
HLLLTHTLPVRTRLKQPKSQFRLRRTPLGSEVTHLELAVVVGPDVYDVHRQDTERYILTN
LNIASELLRDVTLGANIRVHLVRMVILTEPKPDIQISENITSSLKSVCEWGQRVNPDADT
DPIHADLLLYITRFDLVLPNGNKLVRGVTQLGGVCSTQWNCVITEDTGFDLGITMAHEIG
HSFGINHDGIDNTCSSSGFMMASDGGYNSVDLTWSQCSRAQLHNFFSAGKAECVKDVPVL
GGSVQDWRPGLFYGVDDQCRIAFGSSATACSFTNGDMATCRVLSCHINPRDRSSCTRLLV
PLLDGTECGPSQWCLKGRCVSPSTLGSSMMVHGSWSSWSEFSPCSRTCGGGITYRRRQCN
NPRPAFGGTVCKGQDTEAELCNRQSCESTQLEFMSQQCSATDQQPLSVSPDSSSVYTWIP
AVGYSSGDAQCKLMCRSREQDFMVSRGSQFIDGTRCEAAHTAPRGSISACLGGKCQLFGC
DGVIHSGKVEDVCGVCGGNGSTCQFISNTYSGGEAGEYVTFLSLPLNASQVHVINTKPVF
THLAVLLNDKYVVSGDGSPGLSITYPSPLEKSPIIYNLYLTPDHLPQTEELTISGPVTDK
IHIQVFRKYGQEYGDLTTPNISYQYYSSEAVSAERAAKGRWSTVISACSVTCGTGMQKIS
QHCVDVLTLERLEDELCSSSPQAPDQLQPCFQTDCPPSWEVGEFGPCSAPCGVGEQGRSV
TCVQKQVTVKVELPDSDCALDSKPQTTETCNPQICPARWQVSEPGKCSAVCGPGEAQRTV
SCVRSHHGSDSEVDQNLCSEPKPPEHVPCVVDVCPVGWDSQREQIRTDSRVMPRSRMVPV
YVWSPVIGQCSKTCGNGSQQVWFSCVDHQSRLEVPEFLCDRSSKPEMYTQPCSPSKCPAM
WRYIQGPCSVSCGGGVAKRVLYCSQRVEGADGNRDLVVGESACQSVARPSEVVECNTEAC
PARWQAGEQGDCSVSCGMGVAVRCVRCVQYEGGVERVVEEDRCDPGIKPPITAPCFTQVC
SFHWDVHEWSECSVSCGDGIQSRTVSCMGPSSPLPVSPFLCLHLPKPITIQACYSPDCSS
AQTSTPEPNITHMQSEARRGEGTQRTTPAPAVRMMKMRKSFSATAATADVMKSTMSTTTE
PPQTSFCGRLLLQDSGTIDLRNVSQTRCIFAIGRPLDEVIQIKIISSTLNCRQKENIALY
DRLLLMRLCERMTGKTLKSRSNVLLVRQSRLTPGNGVLLFYQSVKNKKSHHGECDVQLFS
PSGLIENPIKSAAAASNTQSCRVFIDAPPAFRIQIRALSVLNNTDTNSTYILIRDVDALK
TTIFRGIRLFLWSSSGSRAEVEFHGEYQQIKGMFRAEYSYINPSEEQPV
NT seq 4650 nt   +upstreamnt  +downstreamnt
atgtggacaaacatgggagctctgatctggctctttctggctccaagtttgttaaaaaca
acagctctactgatttcacaatgcactttgcagaaggattttttagagtcactgaaacct
caagatttattttattattttgataccatttccattaaatcagtgcctcactttgagctg
gtgtgggtgaattgctcaaggaatgagtctttcagagggctatggaggtgctcgtttcac
agcgaagaagagagttttgagctgggccaacacagagatgaacaacccgtgtcctgtccc
acgagtctggagatggtgatcaactcaacagtgagtgtggtgaagaaaagggaggatatg
tgctgcgagcagttgaagttactgagaccagcacatacgagaactcttctccccatctgc
catggcaaattacaaggtctgattcagtcaggggagaagaggctgtgtattcgcccggtg
cttcaaaaacacatagaccatctgaaggagcttactgtggatttaccttctggtgtacct
cacctgctgttgacccacacattaccagtgaggacacgtcttaaacagcctaaaagtcag
ttcaggttgcggcgaacacctctggggtcagaggtcacacatctggagctagcagtggtg
gtgggtccagatgtctatgatgttcataggcaggacactgagagatacatcctaaccaac
ctcaacatcgcctctgagcttctgagagatgtcactctcggagccaatataagagttcat
cttgttcgtatggtcattctcacagagccgaagccagacatccagatctctgaaaacatc
acctcctctctaaaaagtgtgtgtgagtggggtcagagggtcaaccctgatgctgacact
gaccctatacatgcagatctgctgttatacattaccaggtttgatctggtgttacccaat
gggaataaacttgtgagaggtgtgacccagctgggtggagtctgttccactcagtggaac
tgtgtgattacagaagataccggctttgatcttggcatcaccatggctcatgagattggc
cacagttttggcataaatcatgatggaatagacaacacatgcagctccagtggctttatg
atggcatctgacggaggttataacagtgtcgatctcacctggtcccagtgcagcagagct
cagctccacaacttcttcagtgctgggaaggcggagtgtgtgaaggatgtgccggtgctg
ggtggatcagtgcaggactggaggcctggtctcttctatggagtggacgatcagtgtcgt
atagcgtttggcagctcggctactgcttgctctttcactaatggtgatatggcaacctgt
cgtgttttgtcctgccatatcaaccctcgtgaccgcagctcatgcactcgtctccttgtt
ccactcttggacgggacggagtgtgggcccagtcagtggtgtttgaagggccggtgtgtg
tctccttctactttgggttcctccatgatggttcacggctcttggtcttcatggtctgaa
ttctctccctgctcacgaacatgtggaggaggaatcacttaccgcaggagacagtgcaac
aaccccaggccagcctttggtggtaccgtctgtaaaggacaggacacagaagctgaactt
tgtaatcggcagtcctgtgagtcgactcagctggagttcatgtctcagcagtgctcagcc
acagaccagcagcctctgtcggtgtctccagactccagctcagtctacacctggatccct
gctgtcggctacagctcaggtgatgctcagtgtaaactgatgtgtcgctcacgtgagcag
gacttcatggtgagtcgtgggtctcagttcatcgatgggacgcggtgtgaagctgctcat
actgcaccacgtggttccatttctgcctgtctgggtggaaagtgccagctttttggctgt
gatggagtaatacattctgggaaggtggaggatgtgtgtggggtctgtgggggcaatggc
tccacctgtcagttcatctcaaacacctattcaggcggagaagctggagagtatgtcaca
ttcctcagccttcctctgaacgcctctcaggtccatgtgattaacacgaagccggttttt
acacaccttgcggtgttattaaatgataaatatgtggtgtctggagatggaagcccaggc
ctgagcatcacgtacccctcacctctggagaaaagccccataatctataacctgtacctt
acacctgaccacctgcctcaaaccgaagagctcactatctctggaccagtcacagacaaa
atccacatacaggtgtttcggaaatacgggcaagagtatggagaccttaccaccccaaac
atctcataccagtactattcgtctgaagctgtttcagcggagagagctgctaaaggcaga
tggtccactgtcatctctgcctgctcagtgacctgcggcacaggcatgcagaaaatcagt
cagcactgtgtggatgtgctcacactggagcgtctggaagatgagctctgcagttcatcc
ccgcaagcaccagatcagctgcagccctgcttccagaccgactgcccacccagctgggag
gtgggtgagtttggaccctgcagcgccccctgtggcgtgggagagcaggggcgctctgtc
acatgtgttcagaagcaggttacagtgaaagtggagctgcctgactcggactgtgcgctt
gactcgaaaccccaaaccactgagacctgcaacccccaaatctgtcctgccagatggcag
gtgtctgagcctggcaagtgttcggctgtgtgtggacccggggaggctcagagaacagtg
tcgtgtgtccgctcccatcatggatctgattctgaggttgaccaaaacctgtgttctgaa
cccaaacccccagaacatgttccctgtgtggtggatgtttgtcctgtcggctgggattcc
caaagagagcagatccgtacagactcccgtgtaatgccccgctccagaatggttccggtt
tatgtttggagtccagtgattggccagtgctcaaagacctgtgggaacggatctcagcag
gtttggttctcctgtgtggatcaccaatcacggctagaagtcccagagttcctttgtgat
cgttccagtaaaccagagatgtacacccagccctgtagcccatcaaagtgtcctgctatg
tggcgctacatacagggcccgtgcagtgtgtcttgtggaggtggtgtagcgaagagagtc
ctgtactgttcccagagggtggaaggagcagacggaaacagggatctggtggtgggagaa
tctgcttgtcagtctgtggccagaccttcagaggtagtggagtgtaatactgaagcctgt
ccagccaggtggcaggcaggagagcagggcgactgttcggtgtcatgcggaatgggtgta
gctgtcaggtgtgtgcggtgtgttcagtatgaaggaggtgtagagagggtcgtggaggag
gaccggtgtgacccaggaatcaagcctcccatcactgcaccatgcttcacacaagtctgt
tcgttccactgggacgtgcatgagtggagtgagtgttcagtctcatgtggtgatgggatc
cagtctcggaccgtgtcctgcatgggcccatccagccctcttcctgtcagtcccttcctt
tgcctccacttacccaaacccatcaccatccaggcctgctatagtcctgactgttcctca
gctcagacctccacaccagagcccaacatcactcacatgcagtcggaggcccggagagga
gaggggacacagagaaccacaccagctccagctgtcagaatgatgaagatgaggaagagt
ttctcagccactgcagctacagcggatgtgatgaaaagcaccatgagcacgacaacagaa
ccaccacagaccagtttctgtgggcgacttctgcttcaagactcaggaactattgatctg
cgcaacgtctctcagacgaggtgtatttttgctattggtcgacctcttgatgaggttatt
cagatcaaaatcatatccagcactcttaactgccggcagaaggagaacatcgccctgtat
gacagactcctcctgatgcgtctctgtgagaggatgaccggtaaaacgctgaaatcacga
tcaaatgtcctactggtgcgccagagccgcctgacccccgggaatggagtgctgctattt
tatcagagtgtaaaaaacaaaaaaagccaccatggagagtgtgacgttcagctgttctct
ccgtctggactcattgagaatccgatcaagagcgcagccgctgcctctaacactcagagc
tgtcgagtgttcatcgacgctccgcctgctttcaggattcagatcagagcgctttctgtg
ctcaacaacaccgatacaaactccacatacatactgattcgtgatgtggatgctttaaag
acgaccatcttcagagggattcggctcttcctgtggagctcctcgggaagcagggctgaa
gtggaattccatggggagtaccagcaaatcaagggcatgttcagggccgagtattcatac
attaacccttctgaagagcaaccagtgtag

DBGET integrated database retrieval system