KEGG   Sinocyclocheilus anshuiensis: 107692049Help
Entry
107692049         CDS       T04917                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04270  Vascular smooth muscle contraction
sanh04371  Apelin signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107692049
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107692049
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107692049
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107692049
   04031 GTP-binding proteins [BR:sanh04031]
    107692049
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107692049
  Exosomal proteins of colorectal cancer cells
   107692049
GTP-binding proteins [BR:sanh04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107692049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 Roc FtsK_SpoIIIE AAA_29
Motif
Other DBs
NCBI-GeneID: 107692049
NCBI-ProteinID: XP_016346415
Position
Unknown
AA seq 376 aa AA seqDB search
MADFLPSRTAIVCIPNCLLSSGEIDQIRKSKEIDKSLFREKTHVKKLVKILLLGAGESGK
STFLKQMRIIHGQDFDQRAKEEFRATIYSNVIKGVRVLVDAREKLHIPWGDPENQVHGET
VMAFDTRSSMMAKGMVETKVFLNYLPSICALWQDSGIQNAYDRRREFQLGESVKYFLDSV
DKLGQLDYLPSQKDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVT
SILFLVSSSEYDQVLMEDRQTNRLTESLSIFETIVNNRVFANVSIILFLNKTDLLEEKVN
NVNIKDYFPEFTGEPHNLLDVQKFLVDCFHNKRREPQQKPLYHHFTTAINTENIRLVFRD
VKDTILHDNLKQLMLQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccctcccggactgctatagtctgtattcccaattgtcttctctcc
agcggcgaaattgaccaaattagaaagtctaaggagatcgataaaagcctgtttcgagag
aagactcatgtgaagaaactggtgaagatcttgctgttaggagcaggcgaaagtggcaag
tcaactttcctcaaacaaatgcgcataattcatgggcaggacttcgatcagcgggccaaa
gaagagttccgggctacaatctacagcaatgttatcaaaggtgtccgagtgctggtggat
gcccgtgagaagctgcacatcccttggggtgatcctgagaatcaggttcacggggagaca
gtgatggcctttgacacccgctcatccatgatggctaaagggatggtggagaccaaagtc
tttctgaactacctgccctccatctgtgccctgtggcaagacagtggtattcagaatgcc
tacgacagacggagagagtttcagctgggtgaatctgtgaagtatttcctggacagtgtg
gataaacttggacaattggactacttgcccagccaaaaggatatactgctggcacgaaag
cccaccaagggtatccatgaatacgactttgagatcaagaatgttcctttcaagatggtg
gatgtgggagggcagcggtcagagcgcaagcgatggttcgagtgcttcgactctgtgacc
tccatcctcttcctagtctcatccagcgaatacgatcaggtgctcatggaagaccgtcag
accaacaggctcacagagtcgctcagtatcttcgagactatcgtcaacaaccgcgtcttc
gccaacgtctccatcattctcttcctcaataagacagacttgctggaagaaaaagttaat
aatgtgaacatcaaggactacttccccgagttcacaggggaaccccataatctgctggac
gtgcagaagttcctggtcgattgcttccataacaagcgtcgtgaaccgcagcagaagccc
ctttaccatcacttcaccaccgccattaatacagagaacattcgactcgtcttccgtgat
gtcaaagacaccatcttgcacgacaaccttaagcagcttatgttacaatga

DBGET integrated database retrieval system