KEGG   Sinocyclocheilus anshuiensis: 107695556Help
Entry
107695556         CDS       T04917                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00970  Aminoacyl-tRNA biosynthesis
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107695556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sanh03029]
    107695556
Enzymes [BR:sanh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107695556
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107695556
Mitochondrial biogenesis [BR:sanh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107695556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey F-112
Motif
Other DBs
NCBI-GeneID: 107695556
NCBI-ProteinID: XP_016351029
Position
Unknown
AA seq 553 aa AA seqDB search
MAASSSGYSRMFFKLRKYANKSQSLYHTDSFNVVIRTIWTSGSKTQLQPKVHTKSLPQMV
GVVGLEIHAQIQSTSKLFSGSHVRFLAPPNSLVSHFDASLPGTLPVLNRRCVEAAVLTGL
ALNCTINRKSLFDRKHYFYADMPAGYQITQQRVPIAVNGMLVYSYFEGRRRNQVVTKSVK
IKQIQLEQDSGKSLHDDERSQTLIDLNRAGVGLMELVMEPEMCCGEEAAAAVRELQLILQ
ALGTCQANMAEGQLRVDANVSVHRPGEPLGVRTEVKNINSVRHLAKAIDYEIQRQMEVLQ
SAGKVLNETRAFDSKSGNTIPMRDKEGLQDYRFMPEPNLPPLFVYESEASVPAGVDPAQV
VVIDRLSGQLPELPSVKRTRLVETYGILQEHSFTLVNEDGLIDYFENVVQTTKAEPRKVI
GWVIKELMGNLNSQNLNVSQSPISPCALAELISLVESGHISSSTAKQVFQEMWKAPEKTV
GQIVKEQDLWMINDKEELQKICKRIVDSHPEEVQIIRGGNKKVLNKLMGEVQRETKGRTD
PVQIRAILEKMVS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcctcttcaggatacagcagaatgttctttaagctaaggaaatatgctaat
aaatcacaaagtttatatcatactgatagttttaatgtagtgataaggacaatatggaca
tctggatccaaaactcaacttcagcccaaagtccatactaaaagtcttcctcagatggtt
ggtgttgtgggtctggaaatccatgctcagattcagtccacatcaaagctcttctctgga
tctcatgttagattcttggctccaccaaactcacttgtctcacattttgatgcttcatta
ccaggaacactgccagtactgaacagaagatgtgtggaggctgctgtattgacaggcctt
gctctcaactgtaccatcaacaggaagtcactattcgacaggaagcactacttttatgca
gacatgcctgcaggctaccagatcactcagcagagggttcccatagcagtgaatggcatg
ctggtctatagttattttgaaggtcgcagaagaaaccaagttgtaaccaagagtgtgaaa
atcaaacagatccagcttgagcaagacagtggaaagagtctccatgatgatgaacggagt
cagactcttatagatctcaacagagcaggtgtaggtctgatggagctggtgatggagcca
gagatgtgttgcggagaggaggcagcagctgcagtcagagagcttcagctcatcctgcag
gctctgggcacctgccaggctaacatggccgaggggcagcttagagttgatgccaacgtg
tccgtgcatcgacctggagagcctttgggagtgaggacagaggtaaaaaatatcaacagt
gtgaggcacctggctaaagccatagactacgagatccagagacagatggaggttctacag
agcgctgggaaggttcttaatgagacccgagcatttgacagcaaatctggtaacacaatt
ccaatgagggataaggaaggcttacaagactacaggttcatgccagagcccaacttgccg
ccactgtttgtttatgagagtgaagcttcagtgcctgctggcgttgaccctgcccaggtt
gtggtgattgacaggctgagtggccagttgccagagctgccgtctgtgaaaaggacaagg
ctagtggagacgtatggcatcctgcaagagcacagcttcacactggtgaatgaagacgga
cttatagactactttgagaatgttgttcagacgaccaaagcagaaccaaggaaggtgatt
ggctgggtgataaaagagctgatgggaaatctgaatagtcagaatctgaacgtctctcag
agtcccatctctccatgtgctcttgctgagctgatcagtcttgtagaatctggtcatatc
tcatcttcaactgccaagcaagttttccaggagatgtggaaggctccagagaagacagtg
ggccagatagtgaaggagcaggatttgtggatgataaatgacaaagaggagctacaaaag
atctgtaagaggattgtggacagtcaccctgaggaggttcagattatcagagggggtaat
aagaaagtactgaacaaattgatgggtgaagttcagagagaaaccaaaggcagaactgac
ccggtccaaatcagagccattctagagaaaatggtctcatga

DBGET integrated database retrieval system