KEGG   Sinocyclocheilus anshuiensis: 107696680Help
Entry
107696680         CDS       T04917                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00232  Caffeine metabolism
sanh00983  Drug metabolism - other enzymes
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    107696680
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107696680
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     107696680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 107696680
NCBI-ProteinID: XP_016352623
Position
Unknown
AA seq 288 aa AA seqDB search
MDLKEYLNRIGFTGQYGKADLDNLFTIHKLHVMNIPFENLSIHSGEKNTMDLHIIYDKIV
KRNRGGWCCENNLLFSWILMEMGYKSTILGSKVFNSLEQEFLPMDSHLINLVEIDGKQYI
ADVSFGVSCQIWHPLELISGKDQPQLPGVFRLINNGMQWVLEKTSRKQLVQDKAFANSSL
IDKRLTKTLYSFTLTPRDADHFRETSDCLQTSPDSLFMLKSICSLQTPTGFRALIGWTYS
EVTFKEDSDLVDMKEIPDCEIEALLREKFNLVLVNKFTPKNNKADYCI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaaagagtacttgaacaggattggctttactggccaatatggcaaagccgac
ctggacaatttgttcaccatccacaagctgcatgttatgaatattccatttgagaacctc
agcatccattctggcgagaagaacactatggacctgcacatcatctatgataaaatagtc
aagcgcaatcggggaggctggtgttgtgaaaacaacctcttgttctcatggatcctgatg
gagatgggatacaaatccaccatactaggctccaaagtgttcaactcccttgaacaggag
ttcctccccatggactctcatctcatcaatctggtggagattgatgggaagcagtacatt
gcagatgtgagctttggagtgtcgtgccaaatctggcatcccttagagttgatctcaggt
aaagaccagccacagcttccaggcgtattccgcctcataaataatgggatgcagtgggtt
ttggagaagaccagcaggaagcaattggtccaagataaggcctttgctaattccagcctc
attgataaacggctcaccaaaacattatactccttcacattaacaccccgtgatgcagat
catttccgagagacatcagattgcctgcagactagtccagactctctgttcatgctcaaa
tccatttgctcccttcagacacccacaggcttcagagctctgattggttggacatacagc
gaggtcacatttaaagaggactcggacttggtggacatgaaagaaatcccagactgtgag
atagaggctttactaagggaaaagtttaacctggtgttagttaataaattcacacccaaa
aacaacaaagctgattattgcatctag

DBGET integrated database retrieval system