KEGG   Sinocyclocheilus anshuiensis: 107696892Help
Entry
107696892         CDS       T04917                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1A-like isoform X1
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04060  Cytokine-cytokine receptor interaction
sanh04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107696892
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107696892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107696892
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sanh04090]
    107696892
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107696892
Protein kinases [BR:sanh01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107696892
CD molecules [BR:sanh04090]
 Proteins
  107696892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107696892
NCBI-ProteinID: XP_016352945
Position
Unknown
AA seq 529 aa AA seqDB search
MAQLLYVTVILAGVCLHLRLCAGAGQNPDHVLQGTGVKPGSDARRSGDDSTVAPEDAARF
LSCHCSGHCPDDTKNNTCETNGQCFAIIEEDENGDVILSSGCMKYEGSHFQCKDSQFAQT
RRTIECCQFDFCNRDLKPELPPRDTEPPDPHWLAFLISVTVCFCTLICVTVICYYRYKWQ
TERQRYHRDLEQDKAFIPAGESLKDLINQSQTSGSGSGLPLLVQRTIAKQIQTVRLIGKG
RYGEVWLGRWRGEKVAVKVFFTREEASWFRETEVYQTVLMRHENILGFIAADINGTGAST
QLYLITDYHENGSLYDYLKFTTLDTQTLLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDL
KSKNILIKKNGTCCIADLGLAVKFNSDTNEVDIPLSTRMGTRRYMAPEVLDETLNKNHFQ
AYIMADIYSYGLVIWEMARRCVTGGIVEDYQVPYYEMVPSDPSYEDILEVVCVKGLRPTL
SNRWNSDECLRAMLKLMSECWAHNPASRLTILRVKKTLAKMVESQDIKI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcttttgtatgtcactgtgattttggccggagtctgcctgcatctgaggctt
tgcgctggagcaggtcagaatcctgaccacgtgctacagggcactggagtgaagcctggc
tcagacgccagaaggtccggggacgactctactgtggcaccagaagatgctgcccgcttc
ctcagctgccactgctcagggcactgccctgatgacaccaagaacaacacctgcgagaca
aatgggcagtgcttcgccatcattgaagaagatgaaaatggagatgtgatcttaagctca
ggctgtatgaaatatgagggctctcactttcagtgcaaggattcacagtttgcacagaca
cgtcgaaccatcgaatgctgccagtttgacttttgtaatcgagacctaaagccagagtta
ccacctcgagacaccgaaccaccagaccctcattggctggccttcctcatttcagtgact
gtgtgcttctgcaccctcatctgtgtcactgtcatctgttattacaggtataagtggcag
acagagagacagcgctaccacagagacctggagcaggacaaggcctttatcccagccgga
gaatctctgaaagatctcatcaaccagtctcaaacctcaggcagtggctctgggctcccc
ctgctggtgcagcgcaccattgcgaagcagatccagacagtgcgtcttattggaaaaggc
aggtatggagaggtgtggctcggccggtggaggggggagaaggtagcagtgaaagtattc
ttcactcgagaggaggccagctggttcagagagacggaggtctaccaaaccgtgctcatg
aggcacgagaacatactaggcttcattgctgcagacataaatggcactggagcctctacg
cagctgtacctgatcacagactaccatgagaacggctctctgtatgactatttgaagttc
accactctggacacacagacccttctcaaactggcctactctgcagcctgtggcttgtgt
cacctgcacacggagatctacggcacgcagggaaaaccagccattgctcacagagacctg
aagagcaagaatatcctcataaagaagaatggcacctgttgcatcgctgacctcgggctt
gctgtgaaattcaacagtgacacaaatgaagtggacatcccactgagcacacgtatgggc
acccggcgctatatggctccagaggtcctggatgagactctgaataagaaccactttcag
gcctacatcatggcggacatctatagctatgggctggttatatgggaaatggccagacgt
tgtgtcactggaggtatcgttgaggactatcaggtaccatattatgagatggtgccatca
gatccgtcttatgaggatatactggaggttgtgtgtgtcaaaggactgcggcccactcta
tccaacagatggaacagtgatgagtgtttgagggccatgttaaagctgatgtcagaatgc
tgggcccacaatcctgcatcacgcctgaccatcctacgagtcaagaagactttagcaaaa
atggtggaatctcaagacattaaaatctga

DBGET integrated database retrieval system