KEGG   Sinocyclocheilus anshuiensis: 107698017Help
Entry
107698017         CDS       T04917                                 

Definition
(RefSeq) myotubularin-related protein 3-like
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04070  Phosphatidylinositol signaling system
sanh04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107698017
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107698017
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107698017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107698017
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107698017
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107698017
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107698017
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107698017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase Y_phosphatase3 DSPc Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 107698017
NCBI-ProteinID: XP_016354410
Position
Unknown
AA seq 922 aa AA seqDB search
MHLTCKDCKLIRCNFLSVEQCQDWLRRISAVVRPPAPLEELFAFAFLSCSASVSAEDREV
HDGICRAGGHQRRFKRELERMGFDTHSAWRISNINSNYRLCASYPEQIIVPAAVSDQELE
NVAEFRSWKRIPAVVYRHQSSGAVIGRCGQPEVSWWGWRNTDDEHLVQAIAKACVADWAA
NTIQSNTNTIPGELSDCNPHAANGSAEPEPKATPPQRLLIMDARSYAAAVANRAKGGGCE
CPEYYPSCEVMFMGMANIHSIRKSFQSLRTLCAQVPDPVNWLSALEGTKWLQHLSLLLKA
SLLVVNALDRDHRPVLVHCSDGWDRTPQIVALSKLMLDPFYRTIQGFQVLVETEWLDYGH
KFAERCGHGESADDLNERCPVFLQWLDCVHQLPRQFPCSFEFNEAFLVKLVQHTYSSLFG
TFLCNSVKEREEQRVQEKTCSIWSLLRPANTSFHNILYSPRSETVLHPVCHVRNLLLWSA
VYLPNSAPSMPSDESCVPDSAPSASPEDTPVSRLPKTRSYDNLPSSCEGLTPNRRSSDPN
LNEKWHDRLLALEISVTTEACGNHTQTSERGGLDQRLGLNTNVSDELNTDRPENGAELSV
TDSQMQNTQHRKLDLLKNTPAFDIPEESALNESNSEDQTLESEEKRPPASQHPSQTNKNI
ELTPDGLLLDNCTITHDSSECSSQSSMESSSSPNHTTQTLNGICSPSQHPVHPLFPSADR
DAAGDASPTLPHKRPLGVSGRLSALGHLDKDGLSLHSDAVQVRLRQMEAGHQLQVETLKK
QVQELWSRLHVNGKLTSLPDGENNMESGCLQRCGKTDLLSESSWEQIEQQEAEWFSGHAA
SRCYGCERTFWLAARKHHCSGREPVEEAWNCGNVFCASCCDQKVAVSSQQLREHSHVCQA
CYGHLRPPAELELEKPIAASSN
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcacctgtaaagactgtaagctcatcaggtgtaacttcctgtcggtggagcag
tgtcaggattggctgaggaggatcagcgcagtcgttcgaccgccggcgccgctggaggag
ctcttcgccttcgccttcctctcgtgtagcgccagcgtctctgcagaggacagagaggtg
catgatgggatctgccgtgcaggaggacaccagcggaggttcaagcgagagctggagagg
atgggcttcgacacacacagtgcctggagaatctccaacatcaacagcaactacaggctt
tgtgccagttacccagagcagataatcgtgcctgctgcggtcagcgaccaggagttggag
aacgtggcggagttcagatcatggaagaggatcccggctgtcgtttacagacaccagagt
tcgggcgctgtgattggtcgatgcgggcagccagaggtcagctggtggggttggcgtaat
actgacgatgagcatttggtccaagccattgctaaagcctgcgtcgcggattgggctgcg
aacacaattcaatcgaacacaaacacaatccccggtgagctcagtgactgcaatccgcac
gcagccaatgggagcgcagagccggagccaaaggccacgccccctcagaggctgttgatt
atggacgcgcgctcgtacgcggctgcagtagccaatcgggcgaaaggaggcggctgtgag
tgtccagagtattaccccagctgtgaggtgatgttcatgggaatggccaacatccactcc
atccggaagagcttccagagtttgcggacgctctgcgctcaagtgccggatccggtcaac
tggctgtcggcgctggaagggactaaatggctgcagcatctgtctctgctgctgaaggcg
tctctgctggtggtgaacgcactggatcgggaccacaggcctgtgctggtgcactgctcc
gacggatgggaccgcacacctcagatagtggctctgtccaaactcatgctggatcccttc
tacaggaccatccagggttttcaggtgctggtggagacggagtggctggattacggtcat
aagtttgctgagcgctgtggtcacggcgagagcgcagacgatctgaacgagcgctgtccc
gtgttcctgcagtggctcgactgcgttcaccagctcccgagacagttcccctgctccttc
gagttcaacgaggcctttctggtgaagttagtgcagcacacatactcgagtctgtttggg
acgttcctgtgtaacagcgtgaaggagcgcgaggagcagcgcgttcaggagaagacgtgc
tccatttggtctctgctgcggcccgccaacacttccttccacaacatcctatactcgccg
cgctccgagacggttttgcacccggtgtgtcacgtgaggaatctgttgctgtggagtgcc
gtctacctgccaaactccgccccctccatgccttctgacgagtcatgtgtgccagactcc
gccccctcagcctcacccgaggacacacctgtgagcaggttaccaaagacacggtcgtac
gacaacctgccctcgtcctgtgagggtttgaccccaaaccgccgcagcagcgacccaaac
ctgaatgagaagtggcatgaccgcctgctcgcattagagatcagcgtgacgacagaagcc
tgcggaaaccacacgcagacgtcagaacgaggcggcctggatcagagactcggcctaaac
acgaacgtttctgatgaattaaacacagatcgtccagaaaatggggcggagctttctgtg
actgacagccaaatgcaaaacacacagcacaggaagctggatcttctgaaaaacacacct
gccttcgatatcccagaggaatcggctctgaatgagagcaacagtgaggaccaaacactc
gagtcggaagaaaaacgcccacctgcatcccagcatccttcgcaaactaacaaaaacatt
gaattaacaccagacgggctgcttctagataactgtactattacccatgattcttcagaa
tgtagcagccagtcttccatggaaagttcttccagtccaaaccacacaactcagactctt
aatggcatctgctcaccttcccagcatcccgttcatcctctttttccgtcggctgatagg
gacgcagcgggagacgcttctccgacgttgccccacaagcgtccgctgggtgtttccggg
cgtttatcggcgttagggcacctggataaggacggcttgagtctgcacagtgatgctgta
caggtgcgtctgcggcagatggaggcggggcatcagctgcaggtggagacgctgaagaaa
caggtgcaggagctctggagccgtctgcatgtcaacgggaagctgacgtctctgccggac
ggggagaataacatggagtcgggctgtttgcagcgctgcgggaaaaccgatctcttgtcc
gagtccagctgggaacagatcgaacagcaggaagcagagtggttctcgggtcacgcggcg
tctcgctgctacgggtgcgagaggacgttctggctggcggcgaggaagcatcactgcagc
ggcagagagccggttgaagaggcctggaactgtgggaatgttttctgcgccagctgctgc
gatcagaaggtggcggtgtcgagtcagcagctccgtgagcacagtcacgtgtgtcaggcg
tgttacggtcacctgcggccccccgccgagctggagctggagaaacccatcgccgccagc
tccaactga

DBGET integrated database retrieval system