KEGG   Sinocyclocheilus anshuiensis: 107698093Help
Entry
107698093         CDS       T04917                                 

Definition
(RefSeq) T-box-containing protein TBX6L-like
  KO
K10180  T-box protein 6
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107698093
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107698093
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Other transcription factors
   T-box
    107698093
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107698093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 107698093
NCBI-ProteinID: XP_016354490
Position
Unknown
AA seq 471 aa AA seqDB search
MQAIRDLKHNFSLPPPPSMAGAGDSYHQGNIRMTLEDPELWRSFHEIGTEMIITKPGRRM
FPHCKISLSGLVPYAKYILLVDMVPEDGLRYKWNKDKWEVAGKSEPQPPYRTYLHPDSPA
PGSHWMKQPVSFLKLKLTNNALDQHGHIILHSMHRYHPRFHIVQADDLYSVRWSVFQTFT
FPDTSFTAVTAYQNTKITKLKIDHNPFAKGFRDESTNSKRRANRSMADPERVAKKMNLSK
DSEHGSPRDIQQSSCEGLDDEHVGRKESEVKPERYSPWGGACDRDNGHALRAESPLGSDT
RDIYSSEQLVPGQNTYQPYRFHEYGKSPSPSSSSVGSSSACGSRSSFESRVPDAATVPDQ
DTSSKPSAPEFGLPPCPPHPSAGHQDYAGVLNMAIAQAKPGILGHHPLYTPYSTEQSLGQ
WSGVASTQYPPPPPPHHHLPTEYSTQAVHHGYHHGNVGDWSQYPLFSYSCW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctatcagagacctcaagcacaatttcagtctccctcctccgccttccatggct
ggagccggggattcctaccaccagggcaacatccgaatgacactggaggatccggagctg
tggagatccttccatgagatcggcactgagatgatcatcaccaaacctggcaggaggatg
tttccacactgcaaaatcagcttgtctggattggtgccatatgcgaagtacatcttactg
gtggacatggtgccagaagatggtctgagatataagtggaacaaggacaagtgggaggtc
gctggtaagtctgagcctcagccgccctacaggacgtacctacaccctgattcaccagcg
cccggcagccactggatgaaacagcccgtgtccttcctcaagctcaagcttaccaacaat
gccctggaccaacatgggcatattatccttcactccatgcaccgctaccatccgcgtttc
catatcgtccaggctgatgatctgtacagcgtacggtggagcgtattccaaacctttacc
ttccccgacacatccttcactgctgtcactgcataccagaacacaaagattacaaagttg
aaaatcgaccacaacccctttgccaaaggattcagagatgagagcacaaactctaaaaga
cgagcaaatcgaagtatggctgatcctgaaagagttgcaaagaagatgaacttgtcaaaa
gattcagaacatggaagcccacgagatatccagcagtcctcatgtgagggtcttgatgat
gaacacgtgggccgtaaggagtcggaggtgaagcccgagcggtactccccatggggaggt
gcgtgtgaccgggacaacggccacgctctccgtgcagagtcccctctgggctcggacact
cgggacatttacagctctgagcagctcgtaccaggacaaaacacataccagccttacaga
tttcatgaatatggcaagtccccctcgccgtcctcctccagtgttggcagcagcagtgca
tgtggaagccgctccagctttgagtcccgagtgccggatgctgccaccgtgcccgatcaa
gacacctccagcaagccctccgcccctgagttcggcctgcctccctgcccgccacatccc
tccgcggggcaccaggactacgcaggagtgctgaacatggccatagcccaggccaagcca
ggtattctgggccaccatccgctctacacgccctacagtacagaacagtctctgggacag
tggagcggggtagcgtccactcaatacccccctcctccacctccccatcaccaccttccc
accgaatacagcacccaggccgtccatcacggctatcaccacggaaatgttggggactgg
agccaatacccactgttttcttactcgtgctggtga

DBGET integrated database retrieval system