KEGG   Sinocyclocheilus anshuiensis: 107698997Help
Entry
107698997         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107698997
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107698997
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sanh04812]
    107698997
   04147 Exosome [BR:sanh04147]
    107698997
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107698997
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107698997
Membrane trafficking [BR:sanh04131]
 Others
  Actin-binding proteins
   Others
    107698997
Cytoskeleton proteins [BR:sanh04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107698997
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107698997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set fn3_2 C2-set_2 Pkinase Receptor_2B4 fn3_4 Pkinase_Tyr SusE Ig_6 THB Ig_5 DarA_N
Motif
Other DBs
NCBI-GeneID: 107698997
NCBI-ProteinID: XP_016355622
Position
Unknown
AA seq 27754 aa AA seqDB search
MSTQAPTFTQPLQSVVALEGSAATFEAQVSGNPVPEVSWFRDGQVLTAAALPGAQSSFSD
GHAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTGKQPVSPSRLSVSPIRPVKSPM
TTLKQVAQGEDVLPPWKQEGYVGESSYTSMTTGASYVQTSSTFVHKEQHWEGSFAMQQQA
GGFAIVETAAIPSLTKEQVMPPTIVAGLKNVTVTEGESVTLECQISGHPTPAIMWFREDY
RIENSIDFQITYENSYAHLVIREAFAEDSGRFTCTATSEAGTISTSCYLLVKVSEDIESR
EDFSTVSEHIEMPARQVTVEAKEETMSEISAVSESVEAGAGVAPFFVKKPTVQKLVEGDS
IVFECQVGGSPKPHIYWKKSGIPLTTGYRYRVAYNKDTGACKLEISMTFADDAGEYTIFA
RNPLGEISASAMLLDEEAYELYMKKQEETFKTEVTTIIEEPKVADIPVVVETVTEKEQIL
MQRRMAQQTQIMQSFISEQELQISNLEQRFIQEIEFRLLKITYQELVIEDGEQLDMSVSE
HDAIYPVFNTPVKSYRLREGMSATFHCRMTGTPLPKIVWYKDGKRITHGGRYQMEVLQDG
RASLRLPTVLSEDEGIYTALVSNIKGNAVSSGKLYVEPTGIAQTQLPQPGAVQRIRSTSP
RSTSRSPGRSPARRLDETDEAQLERLYKPVFVQKPSSFKCSEGQTARFDLKVVGRPMPET
YWFHNGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQDSGEWTVVAQNRAGKTTVSMTLTVE
AKENLVRPQFVEKLRNISVKEGTLVELAVKAFGNPLPDVVWLKNSDIISPHKHPHIRIEG
GKGEAHFKIPSCTGSDSAWYTATAINKAGRDTTRCKVNIEVDAVMPQPEKKLIIPKGTYK
AKEIAAPELEPLHLRYGQEQWEDGDLYDKEKQQKPHFKKKLTSVRLKRFGPAHFECRLTP
IGDPTMIVEWLHDGKPLAAANRLRMVNEFGYCSLDYEAAYSRDSGVITCRATNKFGADQT
SATLIVKDEKSLVEETQLPEGRRGQRIDEMERIAHEGGPSGVTGDDNLEKTKPEIVLLPE
PIRVTEGETAKFRCRVTGYPTPKVNWYLNGLLIRKSKRFRLHFDGIHYLEIVEAKPYDSG
DVKVLAENPEGVTEHLVKFEIQQKEDFRSILRRAPEVKAPAPVPTQEHGRVSFEVVKAEK
PSETSKEPKEVVKLRKTERVIHEKLTEETEELRSKFKRRTQEGYYEAITAVELKSRKKNE
SYEDMLKKRKEELLHHAKELGPDAERKKEEESKLTIPKVKPEKIVLSPSMEAPKIIERIQ
SQTVCLGDEVHFRCRVTGKPDPECQWFKNGVLLEKSDRVYWYWPEDHVCELVIKNVLAED
SASIMIKAMNIAGETSSHAFLLVQGKQVVSFTQLLEDQNAKEKDTMVTFECETNEPFVKV
KWMKNNAEIFSGDKYRMHSDRKVHFLSVLIISMNDEAEYSCVVIDDDHIRTSASLYVEGA
PLEIVKNLENTEVPETYSGEFECVLSREDAEGTWYFENKEITPSLKYVVSARRGRHSLSV
KDVRKEDQGKYTFKVGDLKTSSSLKMKLRPVTLMQGLSDLTICEGDIAQLEVRFSQENVE
GSWMKNGQAISASDKIHLVIDKVTHKLLIEDASKDDAGMYSFVVPAQDISTNGKLTVQTI
GFLAPLKDVSTVEGTKAVLEAKISATDITSVKWFHNDKLVTASDRVQMVVKGSKQRLAIN
RTYASDEGQYKLIAGKVDSTCKLSVQPISIVKHMEERVCTETQNVTFEVEVSHPGIDALW
TFKGQPLKAGPKYNIESKGTHYSLTVLNAMKDEEGEYMFMAGEKESRARLIVSGGAINRP
LHDVTVAESQTAELECEVANPTTEGKWLKDGHPIDFSDNIMSENNGAVRRLVIVITRPQD
VGEYTYQVANSKTSGNLKVEAVKIRKTMKNQTVTETQEAVFSIELTHLDVKGSQWIKNGV
EIQPSDKFEITVQGMVHTLKIKNCNTQDESVYGFKLGKLSANARLNVETIKIVKKPKDVT
SLLGATASFELSLSHDDIPVQWMFNNQELPPSTNIKILSERKAHKLIIQSVEGRMAGEYI
AVVGHLQCSAHLQVEYLRVTKPMKNIEVPETHVATFECEVSHFNVPSIWLKNGVEIEMSE
KFGIVVHGKLHQLKVMNASQEDASEYTFVCGNDKVSGNLTVKPILITSMLQDLNAKEKDT
VTFEVTVNYEGIIYKWLKNGVEIRSSDRCQTRCKQFTHSLTIRNVHFGDGGDYKFLAGSA
ETSAKLFVDARVIEFTKHIKDIKVTEKKAIFECELSEPNVPVMWMKDGQELEMSERFKAT
TDKFLQRLMIQTVRMSDAGEYSVVAGASVSKANLIVEGKDVRISEPAEKDITVVEKQRAT
FEFEVNEDDIEGRWLKNGVEIQSFDERFNYVTVRKTHRLTITETYRSDAGEYTFIAGKNR
STVNLHVQIPEPPQIIRDMEPLSVEAGKPARFSVEVTGIPQPQVSWYKNSQALSSGFKCK
FLRERNEHTLLLIEVFPEDAAQYTCEAKNDYGVATSSASLNVEVSEVVSPDTVAPVSPPV
IITSLQNTSAEEGESARFQCRVSGDDLKITWYFRDKEIVQSDNFRISQFDDSCQLEISRA
YVADAGEYTCVARNSGGMVSCSAVLNVNDLSVRTVGRQSVSSTGLTHSEMVSSQTMSETY
SSTMQTFESVSMVMMSTTSVKSIEVQQVTSVEEYSTSPTLTLKMNDVIVSLGDVAQFNCS
FSGQPFTEIIWDHNGRTITNTERVQYVHQGGLISLIILNVHLGDQGSYCCTVKNRKGEIR
TSAQLTVEAKEANPEETLVPSNSISKSSKTENESSKKATDQEKQESLQNVGALTTKWQIS
RHYYPDVIPLLERDIYDAIQPDFLVKLSPEFLAKQRESVSLYYVIKGSPSPFVLWLHNQL
NVEEPRSYSLKHDGPLCCLNIKNIGSEQGGTHSCKVISAAGDKTCSTHLRVDVVKPREEV
PARIHLHSVQSKTTLCKEGLLSVEKPDEQKAIQRREKKRKLVATKEDRVELISDYAKGLD
VMVEGLKIEHKTEPRPLSVLQVVSQTVPLSKERPLVSEVKPHSAIVQKEDWWNNMHAASV
SESHSIEEGLTDSFKAVEKFTCETDVETKVLVQSLHVEEKAISIETCVSLEAAEQDFAVQ
IQEGQSVRQSVLMEEKHTLTGEMSQGFTRSEATKINITTQPLEPLLVSESQESKTLPKEL
TFVIPVPKSHSLDIKQQLEMTLRCAVACEQSLLLADVVKKLEVVEVKEVKVRMEPKYMML
TYLITTAGPPIEITIAFEGEYAQTATLKNELHAAFYSVXNQEKPVLTSEQSNILKLDRPE
RLQVSKATPYPLSSAVLTENVEVFATPKMQSAALQTEAEVSFQSAISQTKTAIQESRHHV
TQKTVESKMDIYSFAETEHREIKTVSAEHYERVVCVSDITVDAPHRKVTVEEPMDVLIQE
DKREVLTEDVLTKHLTEKLFFEIPLKDITAEENSKVTLSVRVKGVKSVNWLSNGVLIKSG
KEFKCLKDHDSYTLVINKVIKMKHEGEYTCEAVSEAGKISSSSSRLTVVSREPPVFKKKI
CDMQSNIGSPVKFECEIEETLNVTFKWFKSGSEIRQSDKFRIISRQSTSSLELLNPTKDD
VGEYSCRASNKHGSDTCSANLNFTASEPARFVKKLTDLSIPMSKKLRLECTFTGAPKMFI
TWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCEVSNVYGTDICHAQVVAV
TEPAHFVKKLTDLSIPMSKKLRLECTFTGAPKMFVTWYKDGKQLYASYRYNTKVTSNSCI
LECLHECNNETTGRYSCEVSNVYGTDICHAQVVAVTEPARFVKKLMDLSIPMSKKLRLEC
TFTGAPKMFITWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCDVSNVYGT
DICHAQVVAVTEPARFVKKLTDMAIPLSQKLRLQCTFTGAPKMFVTWYKDGKQLYASYRY
NTRIIDNTCVLECLHESNNETPGKYSCEVSNSFGTDICHANITTVTEPARFEQKLKDKKV
AMSKKLKLESTFTGAPKIFVTWYKDGKQIYASYRYNTQVVGNTCTLECLHECTKDTPGIY
SCEVSNSYGSDICHAEVTTVSGPAHFVKKLTNQTVQWGQKLRLECSFTGIEKLFVTWYKD
YKQVYASYRCNTKVIGNTCILKYLHECDEDTPGKYSCEVTNEDGSDICHALVTFATERKI
PPTFTKKPSEHIEDAEGKLLKLEGRVSGSQPLSVSWYKDNSEIGTSDIYDISFKSNTAVM
CLKKATVTNSGVYTCSASNEAGTVSFQVVVNITEQKRPPTFDIPLKQVTVSEGERLNLSC
HVCGSPPMKIQWMKDRREVTSSANTKMIFVDGTATLEINQTSKTDAGDYLCKATNSAGSE
FSKTKVTIKDKAGAAPATAPAAPTAPQTVKQRDNLFFIEEPKSIHIVEKGTATFIAKVGG
DPIPNVKWMKGKWRQMTHGGRVNIQQKGQEAKLEIKEVTKSDSGQYRCVASNKHGEIECS
TDLNINEKKESRPEVVKLKKTPSKQKSPKEDKDIDIVELLRNVDPKEYEKYARMYGITDF
RGLLQAIEFLKKEKGEESGRPESEHGREYDEDLAKLVSDLQRRMEHSEPVTLLKDIIDQT
TQVNKEAVFECEIKINYPEITLSWYKDTQKLETSDKYDIKLVDDCQILKIKNCQTSDQGN
YRVVCGPHISSARLTVLESQDHVQKPSPADQIQFTKRIQNIEVNERQSATFECELSFDNA
VVTWYKDAWELKESPKYTFRCEGRRHFMIIHNVTSDDEGVYSVIARLEPVGETKSTAELY
LSGKEFEIRTCSFDVPDTSIHVPDVSSVISFKEESSEFHYEEKFEITECQNWTVQAENVT
YGFSSLQELKKPIEETVTKHVVKRTEEVPMKVMKQPEEKTETSFVQPPVPEKEPEVKKPI
EEKVTSVKVTEQKEQPTRKETKPQVPAEPKATVAEPKSEPKSEPKALPKPEPKSEPKTLP
KPEPKPEPKALPKPEPMPVPKPEPKKVEAPSVKAPEAPKKPEAAPQPSLDIKKDEALTPK
PGTTQIKAFVEIKEIEAPKVKLERKPEPAHAATEPPKKDVSTLLPDESIKDHLPVHSEPS
SVEPASQLKTTQSQPPEPVRKQVVTASPEVIVEQTRKQPPQEVFKAEPESSAKPSEPPQT
DQAKKQVPSKSEPTPKISEPALAHKKEVVEVKAAELPSEKKPVTKANMETEIPSAKVFAA
SEKKTDQFPHTVEVTQKISMEEMFLKEEIVEESESVPHQLEEILSYQEHIIRMDVSHHSR
ESAAEDVKIIKTEVSQRPEPSFELKKTKEIPEMKWSKQEMHTEKKERKLEMSNVETFPEA
VVVLGIETPQKRQDIMPDKKKTSEDMPLQNRDDSPRKELAIQREIDVHKKESIHLQQXVQ
NKRLHEETPQKLPETTPIIKPEEKGTMLKEVHKALERDKKTQAVTTTDSEVVSPAKEPEL
VKKPEPEVPKPTVAPAEQKISPPSKEPTVERKTSPEAPKPIVTPVEQKILPPSKEPTVEK
KPVPEVPKPTVAPVEQKIVSPPKVPTVEKTPSPVAPEPTATPIEQEVNPPTDAEKGPVTA
PGPAGKETTSTTQALLKQKSKIHIKKEEKLDMPTVKKVTRRSKEHPEDHEVISLKTVGKI
LCEEPPTEEGPLLRKVEKTEIVGEEMVYSKAVTEIKLTSSYEVTEDTWSYETATKTEKIS
KGEKKKTEQYKDVRSPLQGKTIAPEIGGREVENKGKQGSKIPMEDEPKIPLKKATKSIST
EKEQETVKLKPVEKLDKVVVGPQKDSNIDRSKDGIGVQKHERLIKDESVSKKKEIDATPT
DKKTKEPIVPKPFVAKGEISKEPEKFPKEAKRILPHDEKPETVTLNPFSKESHADVATDM
VPQEQTEKKPVDIKRPERPETTHIMKDPHIQVKEPGKSEKTYEEAEKIRKLESPHEYQPM
KSTTTPEKTQEGSKEEGKGITKKRIIPTDEMRKEEVLLKPVEGKIIAEKTPSPKVDKPSL
QISPLAKKSPKEEDKPAMAKQFGLSPKEMEREEEISLKPTEPAGLKKTPSPKVGIQKPKP
TESIPMERKSSAKSPKKISPKDSLESVILKKVSKTVSPKEEKTTQEPPFKMTEDKLPMVK
ELSPSVLHLQKIPTQQEEVVYEQEQEVVDGEEEETWGWELAPRDSYGSETFDDTLEDGAV
ETPGIGDKKDGKPKEEPAPGRGRGLRPRQTPSPGDAGRGRGLKPGGGGDKPPGESPFGFQ
LKAVPLKFVKELQDIVLQEAESIGSSAVFECQISPSTAITTWMKDGSNLRESPKHKFTSD
GKDRKLAIIDVQLSDTGEYTCVAKLGNKEKTSTAKLVVEELPVKFTKNLEEETSVLKGQP
MYLTCELSKDRDVVWKKNGQEIKEIPGKIQINVIGLQRAITIQDANNDDAGVYTCECENI
KTQTNVKVIEIVRDWLVKPLRDQHVKPKATAAFKGELFKDTPNWKWYKGNDEIPNEPTDK
TEVKKEGKDISLTIKNAQPDDVAEYAVEVEGRRYAAKLTLGEREAEILKPLASVEVVEKT
EANFDTEISEDDVPGEWKLKGQVLTRSPTCDIRSEGTKRFLTIKNIQLDQAGEVTYQALN
AVTSAMLTVKELEMEFTVPLKDVTVHEKKQAKFECSINKDVPKVIWLKGSDIVTQGNKYE
IIDDGKKHILIINNCGFEDEGEYSIEVLGKSSKAKLMVEGMRLNFTSTLKDLTVKEGKTA
LFELELSHENVAVTWYKNEIKVXHTLEIKEVSLDDTCLIKAEAKGISTMAKLLVIEGDAN
FTTKLQDYTAVEKDDVTFDCELSRDVPVKWFKNEIEIKASKMVTMKVEGKRRILNLKKVE
NKDKGLYVCDCGTDKTLANLNIEARDIKVVRPMYGVELFDGETARFEVEISEDDVHGQWK
LKGEVLSSSPDVEIIEDGAKHTLTLYNCKVSQSGEVVFQGANAKCSVNLKVKDLPISFVM
PLNDVQVYEKDDARFEIELSREAKVVRWLKGSQELKADEKFEILTERKRHILVVKSAAYE
DEAKYMFEAEDKRTSAKLVIQGIRLEFVRPIKDVTVKERETAEFRIELSHEKIQVTWYKN
DVRLHPSKVVHLSEDGKIHTLSFKEVSIDDTSLIKVEALGKSSEAMLTVLEGEAYFTTKL
QDYTAVEKDEVVLMCEVSKSSAQVKWLKDGKEITPSKNVLIKADGKKRILTVKKAEKANI
GEYVCNCGSDKTAAKLNIEERDIKIVRPLYSVEVTETETARFETEISEEDVHGNWKLKED
ALHQSADCEIKEEGTKHMLILYNVRMDMAGGVDFSAANAKSSAQLRVKARTIGLLRPLRD
VTVTAGETATFDCELSYEDIPVEWFVGPTKIEPSDRSLNDVEVKEKESAKFECEVSRESA
KVRWFKDGAEIRKGKKYEIIAKGLQRILIISKAVFDDEAEYECDARTSKSSGMLTVIEEE
ARFTKNLSNVEGTETDSIKMICEISKPSAEVTWYKGDQEIPEGGRYEHVADGRKRILIIQ
DLRMDDAGEYQCKLPASETKGTLKISELAAEFIARPQNQEAVEGEKAEFVCSVSKENYEV
KWFKGDKEITTDDKYEIVVDGKRRALIVKNCKLKDEGAFTAHIGSVKASADLLVIEKLRI
ITSIKDTQVKEGQEIVLNCEVNSEGAKAKWLKNNETMFESSKFVMVQRDTVFSLRIKAAE
KSDKASYTITLTNQRGEQDKCSANVNVLEEALKIIEPLEDCEIEEKKTITFACKVNRPNV
TVQWMKAGQEITFSKRILYRVDKDKHALTIKDCSLADEGEYSVVAGTDKSTAELIISEAP
TDFTAQLRDQTITEFEDAEFTCKLSKEKAHVKWYRNGREIREGPRHHMEKDGKECKLVIK
ECRPDDECEYACGVEDKRTRACLFVEEIPVEIVRPPTDVFEPPRSDIVFEAELNKDRVEI
KWMRNNMIIVQGDKYQMISEGKVHRLQVCEIRPRDQGEYRIVAKEKDARAKLELAAIPKI
KTTDQNLVTDAGKPFVMTVPYDAYPRAEAEWFYHDISLPGQNIDTSNERTEYRLKDPKKS
DQGRYKIVIKNKHGTGEAFINLDVIDVPGPVKNLHVVDTADGEVSLAWEEPESDGGSKIL
AYVVERRDVKRKSWTMATDRADIPEYCVGGLQRDNMYFFRVCARNRVGNGETVTTDEAVQ
AKNKFDVPDAPQKVMVGVVNRFGATVSWEPPLFDGGSEITSYIIELRDRTSVKWEPVMVV
KAEDRTATLNDVVENKEYIFRVRAENKAGIGQPSAATDPVKIMDPIERPSPPLNFNYTNQ
TKDSVQLSWETPISNGGSMITGYIIEKCEDGSDKWLRCNARLCPDLYYRVSGLKFGQKYH
YRVCAENAAGISDPADAIGPLLADDPHVGPTMDLSGFKNGLEVIVPNALVIRVPITGYPV
PKPKWTFGDKVLTAGDHVSMVTKPTYTELIVAPSVRPDKGTYTLQLENDVTSVSGEIEVN
VIACPSAPKDFKVAEVTRHHVHLMWEAPDYDGGSPVSGYNVEKREVSRKTWVKVMSGVQD
FEYTVTDVIEGKEYLFSVIACNKCGPGEPAYIDEPVNVSSPATVPDPPENLKWRDKSAKS
IFLLWEPPRYDGGATVKGYIVDKCQRGTDKWEACGDLIPELKFQVTGLTEGQWYAYRVRA
VNRLGASRPCKATDEILAVDPKEPPEIQLDVKLLAGLTARAGTKIDLPADVLGKPEPRVK
WTKADHVLKPDDRITIDTKPGHSTLSITNTTRSDTATYIIEAVNTSGRATATVDVNILDK
PGPPAAFDISEITNESCCLAWNAPRDDGGSPVTNYIVEMRPTDKEEWQKLSATIKQTAFK
ASKLIPMKEYVFRVSAENHYGIGTPAEHVPIVAKYSFDTPGAPTRVQPSDITKDAVTLTW
YEPDEDGGSPITGYWVERFDPETEKWIRCNKLPVKDTSYRVKGLPTKKKYKFRVLAENLA
GPGKPSAETDPVLIKDPIDPPWAPGKPFIKDIAKTSADLQWTRPEHDGGAKIESYIIELQ
KSGAEEWVRVAEDVPTTEHLLKGLMEMQEYSFRVKAVNVAGESEPSDPSDPVVCKERLYP
PNAPRWLEVVNITKINCDLKWTEPDSDGGSPITNYVVEKRDVRRRAWQAVDTTVKDTKYT
VTPLNEGSLYVFRVAAENAVGVSEFCELEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLK
WEPPSSDGGRPITKYVIEKKEKVGTRWVKSGKTSGPECKYKVTDVDEGSEVQFQVRAENE
AGVGDPSEPTVIMTIEDPISPPSPPLEVKIVDASREHINITWKAPEKNGGSPVTGYHVEL
SEAGTEKWMRINARPVKELRFKAEEGIIPEKKYVLRVRAINAIGVSDPSEISEGVFAKDP
DCAPTMDLQTQDIVIVEGEKMDVKIPYRAIPKPSMVWKKGDTELKTEDRLTLTCELNRVH
LELLKCKHEDAGVCTVTLENSLGSITGTINVKVIGLPGQCKDISSSEVTKNSCKISWEPP
ESDGGSPILHYVLERREAQKKTFLPVMSGDNVLSFVVKDLMLNGEYYFRVKAVNKIGSGE
FLELRNPVITEEQKQRPDPPIEVEGHNPISNSITVTWMTPPYDGGCPITGYILEKIEKDG
DRFERCVPNLVPGFSYTVTGLTEGKEYQFRVRAENIAGASDPSRSTPLIKAADPVEPPKV
SLHVRIASGLSIKKGEEIRLDAYISGSPYPTVTWLRNDENVRQPSAKKKSEIVKKKKKKS
VQPEPEEEFHPPLLDRLSFDQIKRGETALMVRDAIRTDHGMFTIRVENPHGVATASCEVN
VLDKPGPPANFGFDEIRNTSVVCMWDAPLDDGGSEIINYILEKKDNTTDEIGWVTVTSTH
KGYNYPVTKLIEGKEYIFRVTAENKFGCGHPCYSEPLIAKNQFEPPDAPNMPRIGEVTYS
TVALSWHEPKDNGSPILGYWVERCEVNSKYWTRVNNNLLNSLSVKAEGLMEGLVYVFRVC
AENLAGPGEFSPPTDPQTAMDAILPPGPPVPKIVDVTNTTIDISWVPPLYNGGGEILGYH
VERCLVGEKDWVRCTEFRCKDRKYTVTGLTEGADYYLRVYAVNEAGHGAPGMTEPVQAKE
PEEAPGVEFDVSVRNGVIIRAGETLRLPAVVTGRPVPEVKWTKDDAEPDKEHTVIETEGK
NSSLTIKNALRTDHGIYQITGTNLSGTKSASVKVDVMDVPGPVVDLKTVHVTKKIISFTW
SDPLDNGGSDIMGYVVERKDAKMHIYRQPLEVAACKCDIVGLLDGEEYMFRVVARNKYGP
GAPVELGPVLAVDPKGVPSAPEKLHYKERTKSTITLTWEPPRSDGGSPIRGYYVEKMRQD
SNEYDVANRQLCKDLTITLENLSENTMYDFRVKAVNEVGDGEPSKPISVNIQDDELIPTV
KWLKFFKSDAIIVKKGAAIEIPAEIVGLPLPAFEWTKNGVVIDQPTETMTLESEEINGQT
INTKIGIPETVRKDTGIYKLTATNTRGVGQRTIRVDILDRPLPPRNIVVSDIKAESCYLT
WDAPEDNGGSDLTNYIIEKRDASKKKSDWEQLTCCVIDRRYGVYKLEAYGTYQFQIKAEN
KYGVSDGCESEKVVLKDPFGLPGPPQRPRIISHSRSSMLVTWDPPKDNGGSTIQGYWLEK
RERGAVYWSRVNRAPVTKPAVRGLEYNVLHLIEGSEYQFRVMAQNAAGVGPPSEATECVF
ALDPRKPPSQPPAPEVTDKTTSSVSLSWTPPEKDGGSPIKGYIVEVQDEGSLEWRRFNTP
DKLILTNSYTVSGLKENKKCRFRIVAVNAAGESEPSPRTGDTIVQDILEEPVITMEVTAH
ELLNCHAGTTINIPATISGKPIPNVTWDFDGTAPTEKKNERHTLPQDSEISSSDTTSVVT
IPECKLNHSGRYIITANNQAGTKIVKVRVNVLDLPGSPKDLKISDITRGTCRLSWKLPDC
DGGDRIKSYFVEKKTVEGKAWTKVNPACATQSLVVPDLIEGQEYLFRVRAENRFGLGPHI
TTIQRTKARDPIHPPDPPTRVKIVDVSKGIVTLTWKAPKNDGGAPVTHYNVERLWWDSSG
NQQESWRQCNRRDIDTTTFKVEDLHQGAEYEFRVKAVNEVGASRPSSTAGPIIIKDQNRT
PSIELPEFMEVEQGSDIHIVAKIKGCPFPTLTWQKAPPHKSENKVDVEYDEHINKLVSDD
SCTLLIQQGKRSDTGLYTLTASNSLGTVSKEMRLNVLGRPGAPSAPIKFEEIRAEQIMLS
WLPPKDDGGSKITNYTIERRVVNRKTWIPVTCEPKERIFTVDNLMPGHEYSFRIRAQNKY
GVGEPLDSEPEVARDVFMPPGQCDKPTLSSVTIDSMTVNWEEPDSDGGTPITGYWLERKE
TTSKRWNRVTRDPVRPMPLGISHRVTGLIDGSQYLFRVMAINAAGCGPPSEPSDPTFARD
PIAPPSPPTPQVMDWTKTTADLEWIPPLKDGGSKIMGYHVEYKGEGTEAWVKAKDKEVRG
TKFVVTGLKENAFYKFRVLAFNAAGLSEPGEVADALEMKDRIILPVLELDISVKEKMVIH
AGGVIRIIAYVSGQPSPVITWSRDGYPVPSEAVIETTSISCSMVIKDCTRAQRGVYTITA
KNEGGEVKKSVIVDVLDIPGPVGAPFTAENLTSDSCKLNWFFPDDDGGSAISNYIIEKRE
ADRKAWTSCSYSAGRQNAIVNNLVLKKEYFFRVAAENAIGVGPFCQTTCEIVIKDRINVP
DRPEDLEVTAITKDYISVTWKPPKYDGGSEVISYILEARMIGKDKFVRLTKETLMDRKYT
YDGLREGDTYEFRVRAVNEVGPGKPSFSTKPIACKDELEPPTIELDFRDKVVVRVGESFA
LQGRYTGKPTPSVTWSRDDKELKSDDHIKFKNTTTTMCLGIIKAQRGHSGKYCVTVENCT
GARKGVCNVTVADRPLPPEGPVVFEEVHRDHMVISWKPPLDDGGCEISNYIIEKRDVNRD
MWTTVTSATTKTHCKVPKLVEGREYIMRISAENMYGISDPLESEEMKAKDLFRVPEAPEP
PIVKDVFHDSALVIWNRPRDGGKPITNYILERKEPSAKRWSRATRDPIYPATQYRVQDLV
EGCEYEFRVMAENEIGTGDPSLPSKPILAKDPTVKPSPPVLPEAVDKTKDSVSLSWRVPR
HDGKGKIFGYLIEYQKPGAIEWIQANETPESCPDTKFVVTNLSEGGEFLFRIMAVNAAGK
SEPAYVKEPVKVHDRLEEPELLLDANMARDHLAMVGTDITLSAKFKGMPIPTVSWKKNDG
EVPAHCLIEVTASGSKLHIKKCTRADCGNYTITVQNAAGTKSATCTVLALDKPGPPRNFK
ISEVTSESAYLTWQKPEDDGGAVISHYVVQKKDVAAENWVPVCAASKKLSLMAQYLIEGI
QYLFRVAAENQFGRSAFVETTKPIKAVDPLYPPGPPKNLHHVNADKTEVWLQWEWPDRTG
GSEITGFIVEHQEEGSTDWVTFKTVSNPQCHVTGLVEGKTYRFRVKSQNAIGISRPDTSV
PITCQEKTLAPTIEVDVKLIEGLVVKAGSTIILPAVMQGIPTPTAKWQSEGNELKTEGKF
KVVTEGNSTVLTISECVRTDSGEYGLTVANPAGSKSVALHVTVLDVPSAPVGPVNILEVT
PDHMIIQWRAPKDDGGTPMMNYIVEKKDVKKPWEPWSVVSSGSTSTKAKVPRLEKGREYI
VRVRAENKIGIGAGLESPPTIAKHMFDPPGPPGQPTCSDITENAVTVSWTEPETDGGSPV
SGYIVERREMTGKWIRVNKTPVLDVRYRVCGLFEGNSYEFRIFAENVAGVSEPSYPSDPM
KAKRPITPPGPPSNIKLKDWSKSYADLVWTKPSRDGGSPIQGYVIECQKAGSAQWDKINK
DLIKFCAFRVPGLSEGTEYRFRIRASNKVGDGEPRELTETVLAKDILVPPDVTVDVACRD
LLTVRAGQIINLVTRVKGRPDPEITWTKDARVLGRDKRTEMNNNFPLVELVIQEAVRADY
GKYAIQAKNSSGQAQATIIVNVLDIPGACQNLKVAYVIKDYCMVSWENPEDNGGTEITNY
IIECRQPSQRRWTVVSSDCTKRLFKAPLVENCEYFFRVSAENKIGAGPLTETKAPVLAVD
PVEKPGEPENFQIAEIGKTFVFLKWKKPEYDGGSRNLAYHIEKKPKEADEWERLHKGAIK
ETYFMADRCIENQIYQFRVQTKNEGGESNWVTTAEVLVKEELVQPELKVKLVGVLVVKAG
DAVPIEAELIGKPQPDVKWSKEGDTADITKSPRVQVETGTNFTKFLLTNSRRGDTGKYII
TATNTGGTCSAEAKVNVLDRPGPIRDLKVSDISVDRCKLTWEIPEDDGGCEIYNYIIEKC
ETKRGVWSVHSAAIITNSAKVTRLIEGNEYIFRVRAENKMGAGPAVETESIVARTQFSRP
GAPDAPEVTKITKDEMVVMWCSPDNDGGKPITGYILEKKEEHAIRWAPVVKSPITGTQMT
VTGLLPNHEYQFRVRAENEIGVGDASKPSRSLTARDPVEPPGPVSNLKVADSSKTSITLA
WTKPTYDGGAPLIGYVVELRVKGTGKKGDEGWKRCNVAAQLIGTEFTVSSLNEKLEYEFR
VSAQNQVGLSQPTNLEEAVTPREVLEAPEIDLDAELKKGVTVRAGCPIRLVATIRGRPAP
RVLWRRMGKDNVVQKGHVDLIDTMTFLVISESTRDDSGKYSLTVSSPAGEKAVFVNVNVL
DTPGPVVGLEVADITMSSCNLTWSPPENDGGSNITHYIVEKREIDRKTWATVKANVDNTT
FKVTNLAPGTEYYLRVVAVNEYGPGVPRATAKSYLASDPISKPDPPQKVDVLEITKNSAT
VGWVKPMRDGGAKIDGYIIDYLELPMPKPPKIPMAAEGEVEPGVEPVAPPPPEPVVEEEK
EEKKEEWTPYTVVKDLSISVAGLKEGRKYRFRVAAKNAMGSSLPTETREAYEIKEQMLEP
KIIMPELVTAKAGAKLRVEALVSGKPAPACQWKRGENNVVPSSRLAVHKSQNMCVLIIKD
VSRQDSGEYSLVAENSTGKVDQTLKIIIRDIPGPPEPPFEISDIDSDACTLSWNKPTEDG
GSNITNYVVEKCDVSRGDWVTALSSCGKAGCRIGKLIPGKEYVFRVHAENRFGISDPLTS
ERMVAKFPFDVPGEPLNCRINKVNKDCMFVAWDKPESHGGSPVTGYYIERKERNSLLWVK
ANDSVVRTTEYPCAGLIEGLEYTFRVSAINRAGQGKPSKKTEFITARTPVDAPGKPEVLD
MTKNSVTLVWTKPKNDGGSKIIGYYVEMMRLPGDTWVRCNTSSQNVPREEYTATGLEEGA
KYQFRVIAKTAVNISRPSEITDPILVSAENVPPRIELSIQMKNMLPVKAGSDVCLEAEVF
GKPMPKVTWSKNGEVLKADKEFKMSQKRHLFSLSLDAVTKLHMGSYGILAVNASGSTTAE
MQLKVLDIPGPPASMKFDEVLSEQIKLSWEAPLADGGSPITNYVVDKRETSRANWAQVSA
KISGDTKECLVERLIEGHEYQFRVRAENRYGTGDGIISDPVVARNPFTVPGACDPPVLTN
ITKERMTVSWKEPSDDGKSPILGYIVEKCETKEINWTKLNRKPLLERTLEVGGLSEGAQY
EFRVTAVNKAGLGKPSEPSNATSALDPLYPPGPPISPKVIDTTSSTIRLTWTKPANDGGS
EILGYLVESKRTNTTDWIRCNVPKNLQDTNYVVTGLLENSEYQLRVTAVNKVGFSQPCEF
LEKHVAKDVFAAPEAELDAQLKDTVVLTAGSKMKLHATIKGRPIPRVTWAKMNTNIKDRH
GIIIKTTDTDTLVYVDKVNRYDAGKYILNLDSVSGMKMYTVIVKVLDTPGPPLNLMVKET
SKDSASILWDAPLIDGGSEITGYIVDKRDAERKAWSNVSTTCTQTSFKIDGLEAGRSYCF
RVLAQNQFGIGEPCETVDAVRASEQPGPVMDFKTLLVTKESCTLSWKKPISDGGSRIIAY
VLEVLNGEDKWKELLRSKNMQYSAKDITEGREYKYRVKATNDSGDGPVKELSVIAKDVNV
SPSCDLRELPNLNYIAKEGSTVRLKIPISGKPVPVVTWKKGEDENLTDTGRVCVESTAVN
TTLMIRDCQRTDASKYTITLRNAAGTKESTIFVRVVGKPGIPAASVKFKEVTADGATLKW
GVPKDDGGSEITNYILEKRDSITNMWVTVSSSVDTNTFRVTGLHEGTEYIFRVSAENKYG
IGEGLKSEPMVAKHPFNVPDSPPPPQVMSMYHDSATLAWFDPRKTGGSPITGYHVEFKER
NSMLWKRANPSALKMRDFKVTGLTEGLEYEFRVMAINLAGVGRPSPATEPMVALDAIDAP
GKPDVISITRSTVTLQWTEPQYDGGHRLTGYIVERRDLPAKVWVKANTINVVDCAYTVAD
LQEGCKYEFRIRAKNAAGAISPPSEQTDTLVCMDEYAAPTIIIDPTVKEGLTVKAGDTIV
ITATSILGKPQPTSVWSKGGKYFKPSDVCQIETTPSSSTLSIKYASRKDSGEYTITASNP
FGVKEENVKVKILDVPGPPEPVEASGISSEKVTLTWTSPHEDGGSPIKYYTLEKRETSRL
LWTILAEKVIDCHFVANKLIQGNEYIFRVSAVNSSGAGDASHSEPVKMVDSYGPPGPPAK
PEVENVGGNSVTIAWKRPADDGGSDIMGYMVERKEKEGMRWTRASKKTIAELHFEVKGLK
EGVEYEFRVTAENKVGFGEPSEPSMPVRTKLVADVPSPPVNPRVTDTTKTTAELHWGKPL
SDGGMEVTGYLVEHKKEGEEEWVKDTATPLRITEFVVPNLQAGTKYNFRICAMNAMGVSE
PAQTKDHVEIVECEEIPDLELDIELRRTLVVRAGASIRIFIPIKGRPTPTVTWTKEDSSL
KTRAIIDNTESYTLLVIPDCNRRDAGKYDLTLENAAGKKTASVVVRVLDSPGPPLNLKPK
AIDKENITLEWEMPLIDGGAKITNYIIEKRESTRKAYAAVITQCDTCSIRVPDLAEGLEY
YFRVYAENEYGIGEAAETPDPIRVSQAPTPPENVTFTDVTKNSVSLVWTKPKHDGGSRVT
GYVIEAQKKGTDQWAHVTTVKTLDFTVKNLNENEEYIFRIMAVNSSGRSRPRVSKPVVIK
EQSSEPEFDLRGVCQKTVIAKAGDDIKIEVPVSGRPKPTLSWQKDNQALKLTQRTMIKNT
STSTILIINECLRSDCGIYSMTGKNIVGSVTDSITVKVHDVPGPPKGPIKLDKISRTFIE
FSWEAPENDGGVPINNYIVEIRETTSQTWVELSSLIIRTTFKATRLTTGTEYQFRIKAKN
RYGTGPPLTSEAVVAAYPFKVPGPPGTPKVVAFNKDTMTIGWNEPVSDGGSEVIGYHVER
KERNSIVWHRISKALVIGNLFKSTGLEDGVAYEFRVIAENIAGIGKPSKASEPMLALDPV
DPPGQPVPIHMSKNAITIQWTKPEYDGGFKITGYTVEKRDLPAGRWIRANFTNIIETTFT
ISGLTQDESYEFRVLARNSAGAVSNPSDPSDPIICKDDIEEPRIMVDAKFKDIVLVKAGE
VFRLEADVAGQPLPSMVWSKDGKDVENTAKLQIKMTELTAVLINKDSVRSDGGEFILTAT
NVGGFAKHVFNVKVLDRPGPPKGPLTFSDITAEKCVLTWNPPADDGGANIQHYVIEKRES
SRLAWTNVASELQVNQYQVTKLLKGNEYIFRVMAVNKYGVGEPLESEAIIADNPYVRPDP
PQTPEITAVTKDSVVLCWGAPASNGGSEITNYRIEKRDRISLRWVKCNKRNVTDLHFKVT
ALVPGHEYEFRVFAENAAGISEPSPSSPFVKATDTLFKPGPPGNPRILDTTNSSITLAWN
KPVYDGGSEITGYILETCLPGTEEEEWTIVSPKDGVKGTSFTITNLKENQEYKINVSAVN
CEGIGEAAPVPGSPKAEERLIPPEADLDAELRKIVNIRACNTLRLFVPIRGRPTPEAKWS
RENDEPLDRATIETTSSFTSLVIDNVNRFDSGKYNLTVENNSGAKTVSVIVRVLDTPGAP
QNLKISQVTKESVSLVWDPPLNDGGTKIKNYIVEKREATRKAYATVNANCHKTTYTVDQL
QEGCNYYFRVLAENEYGIGLPMETGESVKVSEKPLPPGKIALQDVTKTSVTLSWEKPEHD
GGSRVVAYVVEMQSKGNEKWTQAVIVKVPEAVITGLVPGEEYMFRVSARNEKGTSDPRQI
GVPVIAKDLVIAPSAKMLFSTFSVLAGEDLTIDIPYNARPKATISWLKEAVPLKRTTRVN
FSSMDTQLNLVIKEACRDDVGQYSIKLSNTAGETKVDIRIVVLDKPGPPTGPVKVDEVTS
DSVTISWQPPEHDGGCTINNYIVEKRDTSTTNWQIVAANLARTQIKAGRLKTGSEYQFRI
AAENRYGKSPLLVSECVVAQYPYKLPGPPGTPFLQSSTKYSMVIVWNEPVIDGGSTILGY
HLERKERNSILWMKLNKSIIQDTTFKTTGLEEGMEYEFRVYAENIVGIGKASKISEGYTA
RDPCDPPGTPEAVRITKNYITIEWTKPEYDGGSKVTGYIVEKKELPAGRWMKANFTNIIE
TEYTATGLTEDEKYEFRVIARNAAGVFSDPSYSTGPIMAKDEIEPPRISIDPEYTQTIVV
NAGDNFKIDADIHGKPTPSICWMKGEQELGNTISREIKSTDSYTCLTVKEAKLADGGQYT
LHLQNPGGEKTVQVDICVLDKPGPPEGPISITGVTSEQCCLSWKPPKQDGGSKITHYIVE
KRETSRLLWTVVEPKVQVLNLKIMKLLEGNEYIFRVLPVNKFGVGEPLQSSAGVIKNPFT
PPDAPKGVEVSNVKKNSMIITWEAPTNDGGTPITGYIIEKRDKEGIRWTRCNMKTVTNLT
FKVTGLLENHLYEFRVSAENAAGVSEASSATVFYKALDPVFKPGPPHNPKVLDMTKSSVV
LAWGKPIYDGGCEIQGYIVEACEAKAAIEEIQTPGEEGKAAADEWTICTPPTGVKLTRFN
VENLKEKQEYKFRVCAVNKVGVGEHADVAGSILPEDKTEEPDLDIDAEFRKVVRIKAGGS
LRMFIPFKGRPAPQIKWEKDGGQIKETAQTETSSSHTSLVIDKVNRADSGKYTVTAENSA
GAKSETIIVKVLDTPSAPLNFKVKEITKESVTLTWEPPILDGGAKIKNYIVEKRESTRKT
FSAVVTNCHKLSWKVEPLQEGCSYYFRVLAENEHGIGLPADITDPLKVSEVPQCPGKLSV
VDVTKTSVSLSWEKPIHDGGSRILQYLVEMQVKGNDKWSGCANVKTLEAVISNLNPGEEY
TFRVIAINEKXXXXXXSDPRTLAVPVQAKDLVFGPDVRPAFSNYSVLVGKDLQVEIPVSG
RPKPKVTWTKDGAALKFTTRVNISNTAHSTVLNIKESAREDGGMYGINVSNVVGQKDATI
EIITLDKPGPPTGPVRFDEITVSSVTLSWDPPKYTGGCPISNYIVQNRDTTSTTWENVAI
SLARTTLKVVRLKTGAEYQFRIIAQNRYGKSYALDSSTVVAQYPYREPGPPGTPFVSCLS
KDHMVVEWNEPVSDGGSTIIGYHLERKERNSILWSKINKTLIQETRFKTSPLEESVEYEF
RVYAENIVGIGRCSKISEGFVARDPCDPPGTPEAVHVTKNSITIQWTKPEYDGGSVITGY
TVEKRDLPEGRWMKASFTNVIETNFTVTGLTEGAKYDFRVIAKNAVGTISKPSYNCGPIA
ALDEVEPPKFSIDPEYTQTLVVNAGDTFKLDADVHGKPLPAIQWFKNDKELENTIRCDIR
NTDNRALIIVKDAVRQDGGNYTLQLTNVAGSQTVQFHVKVLDKPGPPEGPLHVTGVSSDK
CTLIWHAPLDDGGNTITHYIIERRETSRLAWTVVCNDCKTTTYKVTKLLEGNEYIFRVMA
VNSYGVGEPTEAPSVIMKDPFSQPGSPQIIEVTNIAKDSMTICWSAPDTDGGSKILGYII
EKRDRSGIRWTRCNRKKVTDVCFRVHGLIEDHEYEFRVSAENAAGIGEPSLPTSYYKACD
PKYKPGSPMHAHVVDTTKTSITVAWGKPLNDGGCAIQGYIVEICKAEEEEWTMCTPPTGL
RVNKFEITKLTEQQEYKIQICAINKLGVGEPAVIPGTAKPEDKLETPEIHLDSELRKGIV
VRAGGSVRINVPFKGRPIPDIKWTKDEGELSEKTVLEKGLNFTQLSIDSCDRRDSGKYTV
TLQNSSGSVSEFVAVKVLDTPGAPLNLVVKDIKKDSVTLVWEPPLIDGGAKIKNYIVDKR
ESTRKAYANITTKCSKTTYKVEDLAEGAMYYFRVMAENEYGVGLPVETKTASKASEVPQP
VGKVMLTDVTKVSASLAWEKPEHDGGSRIAGYLIEMQPKGTDKWGVAANVKTCAGTVTGL
TGGQEYLFRVLAYNEKGKSKPKTLAAPVIANDLTIEPSLKLQFNTYSVKSGKDFKLEIPI
FGRPKPKITWSKDGQSLKVTSRVTTFFTPTSTILQITEACKDDLGKYTVTATNSVCAVTE
DISIIILDKPGPPTGPIKVNEVSNNSVSISWEPPEYTGGCQVKHYIVEKRDTTETTWQVV
AGSVARTSLKITKLKTGAEYQFRVIAENRYGKSAPLDSKSIVVQYPYKPPGPPGTPHVKS
ATKDQMIIEWNEPVSDGGSSVIGYHLESKERTSILWTKLKKTLITDTVFKICNLEEGIGY
EFRVYAENIVGIGRASKVSESFVARDPCDPPGTPEAVTISKDHIKIQWTKPQYDGGSKVT
GYIVERRDLPEGRWMRANFTNVIETEFTITGLTVNNQHEFRVIARNAVGVFSEPSDSTGP
ITATDEIEPPSVSMDPKYKDVIVVNAGDDIVLDADIHGKPTPDIQWLKEGKEMDKTLRIE
VRITQKYASITIKDCTRLDGGDYELVLSNCGGTKTIPITVKVLDRPGPPTGPLRVTGIMS
DKCHLSWSEPLQNGGANISHYILEKRETSRLSWTAVDSNIPSVNYKVTKLLPGDEYIFRV
MAVNKYGIGEPLESEAIIARNPYKPPSVPSTPEASEITKDSITLSWNAPESDGGAEIKCY
HLEKRDKDGVRWTKCNRQKLTDLHFKVTGLSEGHFYEFHVSAENEAGVGEFSDLSLFYRA
INATTPPGPPHHPKVTDHSSSSVSLSWGKPATNGGAYIKGYIVEMKEVSSEEWIICTPPA
GIQATRLTVESLKENAEYNFRVCAINSEGVGEPADVHGSVTASEKIEAPEIELDADLRKV
VSVRAGGSLRLFITIRGRPEPSVKWEKEDGTLTERAQIESTSSYTMLVIDNVNRFDSGKY
NLTLENKSGTKSAFVNVRVLDTPSSPQKFEVKDVKKNSVTLCWDPPLTDGGAKITNYVVE
KRESTRKAYTTVTSNCTQTSFKVDELQEGGIFYFRVCAVNEYGFGVMAETKNPIKVAQVP
MPPGKVTLVDVTKNSVTLTWVKPVHDGGSKIICYNVEMQPKSSDKWGVSCTVKVPEATVS
NLTPGETYSFRVTALNEKGKSEPQELGVPVVAKDIEIEPSVHLLFNTYSVKAGDDLTVEV
PVRGRPKPVVSWKKDGLPLRQTTSLSIVNTMVSSKIVIKEAAIEHVGKYEITLANTAGTK
STDIGIVVLDKPGPPASVKVDAVTSDNITLSWAPPEYDGGCSINNYIVEKRDTNTTEWQI
VSTNVARTSVKVPRLTQGSEYQFRIYAVNRYGKGKPIDSPGITAEYTFKQPGPPSTPRVA
HATKVFMLVTWNAPVNDGGSTVLGYHLERKERSSILWTKVNRTIIKDTEFKVTGIEEGMM
YEFHVYAENIAGIGKASKASEPIAARDPCDPPGQPVVTSITKSSVSLSWTKPEYDGGAKV
TGYIIERRDLPEGRWIRCNFTNVVETYFDVTGLTLDEKYDFRVIAKNAAGLFSEPSDNTG
PITVKDNVDPPRIMMDVKFKDVVVVKAGETLKINADIAGRPLPVASWSKDGHEIEQKAII
QITGTDTSTMIVVKDCKRSDSGQYALTLKNVAGSVTTPVNCVILDKPGPSAGPLSVTGLT
AEECTLSWGPPQEIGGSEITHYIVQKRETSRLAWTLVHGEVKTTTFKVTKLLKGNEYIFR
VLAVNKFGLGEALQSEMVKVTEPYTIPGAPTNVEITSVTSEEMRLAWTKSASDGGSEILG
YIIERRDKSGLHWVRVNRDLVKDLTAVISKVRRGCEYEFRVYAENSAGLSPASDPSPSAR
AEDELLVPSPPTKPKILDHTKNSITIAWKKPLSDGGAQILGYSVEYKNSEDTEWIVAIQM
TKSNEFTVSGLTTDVQYVFAVKAINKVGVSEQSPVSESQSAMERKEEPVFDIDIEMRKTL
IVKHGNSFTLTAPFKGKPVPSVTWNKEEVDLKARASIETTETCTSVTIEKATRNDSGQYI
VTLDNGVGTASLPVMVKVLDTPGPPTNVKITEVTKVSATVTWEPPENDGGDAVKAYHVEK
REASKKAWVCVTSNCHSLTYRVEDLQEGAIYYFRVTGENEFGTGVTAETKDGTKITEKPS
PPARLGVTAVTKNSVTIAWSKPEYDGGSRITSYLIDALEKGQQKWVKCATVKANTHIIKN
LRENAEYFFRVRAENHAGLSEPKEMIIPVVVKDQLDAPEFDMKNFPHNTVYVRAGSNLKF
ELPLSGKPMPKVTMSRGNAPVKCGKRFSFEVTPESLNINLKESTASDAGRYDIVASNTSG
TTKMFVNILVLDRPGPPVGPVEVSDVRETSLCLKWLPPVYDGGSPVTNYVVLKRETSTPA
WTEVSSTIARSTVKVTKLTKGEEYQFRVKAENRFGISDHIDSQSVTVKLPYTIPGPPSTP
WLGYVSRESLTVCWNEPVVDGGSPVVGYHVQMKERSSILWQTVNKTAIPATQIRVTNICP
GMIYEFKVAVENAAGIGKFSKTSEEVLAIDACEPPANVRISEVTKNSISLVWQKPPFDGG
SKITGYIVERRDAPNGRWTKANFTNVIDTNFTVSGLTQDQAYEFRIFAKNAVGSISNPSL
IAGPVTCVDISGAPVIDLPPEYLDVVQYKAGTSFKIKVGIFAKPLPTIEWLKDEKELVSS
AQLSIENTTDSSAILIKDASRLNTGTYELKIKNVFGTASASIRIQILDKPGPPAGHIEFK
SVSADKITIAWEPVADEGGAKVTHYIVEKRETSRVMWSPVSEAMEARTVTVQKLARGNEC
IFRVRGVNKFGAGDPLESEPVIAKNAFVTPGQTSTPEATDITRTSMQIVWDKPGVDGGSM
VTGYYLERRDKKSLRWVKVYKDPISDTKAKAHHLTEGNEYQYRVCAINKAGEGPYSDVSD
LYKAADPVDPPCEPTMLKVVDSTKISITLGWSKPEYDGGSEITSYVVEKRVGEEGEWTVI
SRKGEVRTTEYVASDLKPDIDYYFRVSAINCAGRGDPIEMEEPVQAKDILEEAQVIISWD
EPNDNGGGEITCYTVEKRDTSQTDWKMACSSVIGTSFKVPNLIKGIQYQFRVCAENRYGA
SEPLVSQNVIAKHEFRPPGPPGMPVVYNVTNDGMTIQWDAPIFDGGCPILGFHVEKKEKN
SIMWQKVNIVLVKEREYRIPGLIEGLEYQFRVYAQNDAGYSRMSDASKPVMAVSPVDPPG
TPDYVDVTSESVQLKWEAPKRDGGSKIVAYNVEKRQGKGRWLKTNFSNVTDTEFTVTGLA
CGERYEFRVIARNAIGTVSPPSQSSGYVLIRDYTATKLIKTNEYQFRVSAVNRFGVSRPL
DSVPVIAQMQYTVPDSPGTPDATDVDGESITISWAPPTHDGGNPIKYYIVERREKKTGRW
LKVITRKPIVEAAHRVTHLTEYVEYEFRVYAVNDAGIGAPSNISMPIKCAEPTEEPDAPS
IVNVTDTTNTSVSLEWTRPAYNGGMEIHGYIIEMCKGSEAEWHRVNEDLCAVTKYNVTGL
ETGAEYKFRICAVNSVGKGEAKEIPESALAVDRLLAPEIDIDASFKQTHIVKSGGSVCIR
IGFKGKPTPTASWTKVDGELGVMTDITTTETFTALTLENCTRNDTGKYTLTLENSSGNTS
ITVAVKVLDTPGVPGALSIKEVTRGALTIVWEPPTNDGGARVHHYIVEKREASRRTWTEA
APKTTQTSLRVSDLLEGVPYFFRVMADNQYGLGEAYEMSDPVIATAEPAPPKRVDIIDTT
DTSATLAWLKPEHDGGSRITGYCVESKGKDADKWVVCGTTKNLSLVIEGLTENSEYEFRV
KAKNDSGFSVPREAFSSVIIKEPRIEPTADLSGITNQLITSRIGESFEIDVPISGRPAPK
VSWKLEEMRLKETDRVSIKTNKNRTTLTVKDCMRGDGGRYFLTLENVTGPKTFTVTVNVI
GRPSPPEGPIEISSITSESCILSWNPPEDDGGTDITNYIVEKRESGSTAWQLINSSVKHT
SFHVSHLTKYMQYTFRICAENRFGVSKPTESETIVAEHPFVPPGPPTRPEVFAVTANSMS
IRWEEPYHDGGSKVSGYWIEKKERNTILWVRENKIPCFECYYKVEGLVEGLEYQFRVYAM
NSAGLSKASEASKRAVAQNPVDPPGKPEVKNVSRSTVSIKWSVPLNDGGSPITGYIVERK
PYTVTGEGRWLKCNYTNVTDTNFTITALGEGEEYEFRVIAKNANGVLSLPSVSTGPVTCK
AEYIPPKAELDSKLLVDTVVIRAGSDLVLDAAVGGKPEPKFSWSKGTKELELCEKYALQY
SSTRALAIIKFCDRDDTGKYVLTVKNASGTKTAEVNVKVLDTPGPCQEITVSNISEEKCT
VSWKEPLEDGGDPITHYIVERRDTNRLNWVIMEAECKALTCEIKRLFKNNEYIFRVRGVN
KYGSGVAVQSTPIFARNSFTVPSPPGAPEILAVGKDYATIEWLKPESDGGSEVTNYLIEF
RERKSVRWIKVNRDSVLKDTSFKVTGLHEGNIYQFRVTTMNAAGDGEPSEVSMYAVCRVP
TGTSDPPSIPRVTDTHKDSISLAWTRPVEDGGADVIGYVLEMQEAGAEEWTKVHEKNLRV
TEHTVTGLSAGKKYCFRVAAVNVNGMGDFSEPCAETEPVERIEIPDLELPDELGKTICLR
AGSSLRLHVTVTGRPIPTVTWSKPGVDLQNRGFIEVTNTATTLIIDKVHRYDAGRYTIEA
SNSAGKKDASILVKIYDTPGPTGPIKLKELTKDSAHITWDAPEVDGGAPVNNYIIERREA
SMRAYKTVTSNCSKTSYKITGLTEGMLYYFRVLPENIYGVGEPCETGDVVLVCEVPLPPA
KLEVVDVTKSSVSLAWEKPLHDGGSRITGYIVEACKAGTDKWMKVATLKITDFEFTIMSL
NENEQYLFRVRAVNSRGAGEPKEIVTAVTVQEQRVLPKVDLSAIPQKTISVLAGKPLELD
LPIIGRPPPVCSWFFNDNRVKIVERVKIKSTGKFSKLTILDTTIDDSGVYKLELKNMTGV
TTENIKVIILSKPDEPQGPIRFDEIDATSVTISWDPPTRDGGAPISNYVVDQRDAHRPGW
VPVSESVSRPTFKFVRLTEGDEYVFRVAATNRYGTGDYLQSEIVMCKSSKSIPGPPGRPI
VFDVSRDGMTVAWEPPDEDGGLEVSGYIIERKEVRSDRWIRANKNPVTMTRYRSTGLIEG
LEYEHRVTAINARGAGKPSLLSKPAVATDPVDPPGSPQNPRVTDTTKSSVSLAWSPPDEE
GGAKVTGYLIEMQKVGSVTWMKCNATPSLICEYTLTQMPQGEEFKFRVMACNAGGPGEPA
EVPGVVTITEMLDPPSYDLEAKYKDVLVVRSGGVIKLSVPIKGKPTPTCKWTKDGLEVTN
RAMIASNEDISELVIKQAEKSDSGVYNLHLENKCGKKMLAIKVKVIGRPSAPEGPLRFDD
IQAHSVKVSWKPPTEDGGSEIVGYIVERREVTKAAWYTVDSRVVDTSLVVKGLQENVEYH
FKVTAENQFGISSSLKSETTVVPKTPICVPEASGTPPEIMDVTKNSAALAWTKPKDDGGS
RITGYFIEYKEVSSDKWIRHEAKITSTMYTLSQLTTDSEYQFRVIAVNDIGESEPGPASD
SVICKDPFDKPSQPGEIDTMTVTKDYITINWEAPACDGGKPVLGYWIEYRKSGESAWKKC
NKERTKDKQYTQGGLQEATEYEFRVFAENETGISRPRRTATGIKTKLGVGTKPALRKEMD
EVTAKLGQTATLKCQIIGRPVPEIKWYKGGKEIKEGRKYAATSDGRNHTLTISTDQQEDE
GLYTCKAVNEAGECETSGTLVLEAAPQFPVPLKDKFFATCGSTVRIHAVYIGRPQPKIMW
LYGAKALEPSENVIIENTEHYTHLILKNVQRRVNGGKYRIRINNHFGAADTVTHVEILDK
PAMPEGPLVLDALLKNSVIISWKAPKDDGGSMISNYIVEKREDKEGTEWELVSSSITGTS
CRIPNLVENEGYFFCVSAQNRYGNSESLETPAAILIKSQLQRPGAPLKPVVSGLTKNSCV
VSWKPPLSDGGSKIKNYCLEKRDKKKGEWVAVTTDEIHQTVYSVKGLTEGVEYEFRVKCE
NLGGESEYSEVSDPAIPKTDVEVRAPAFKEDLRNMSVKFKSNATFVCKITGQPKPVIKWF
KRGKEIQADDTKVKIQEFKGGYQQLVIADCDAEDSTVYQIRATNQGGSISATVSLDVEIP
AKIHLPKNLQGKEAIPALRGEVVNIKIPFSGKPDPVITWQKGQDLLDNDGHYQVIVTRSF
TSLVFQNGVERNDAGFYIVCAKNRFGIDQQTVELDVADVPDPPRGIKASDVSRDSVTLHW
VTSANDGGSKVTNYIIEKCATTAERWIRVGQSRDTHYTVVNLFGKTSYQFRVIAENKFGQ
SAPSEPSGPVVTKEDKSRVLNYDEEVDDTRPVSKSKAPHLDAKNVHNKYMIAEELGHGQF
GIVHRCIETSSEKTYMAKFVKVRGADQALVKKEIATLNVARHKNFLLLHESFDCPEELVM
VYEFISGVDIFERLGTANFELNEREIVNYIRQVCEALEFLHSKSYGHFDIRPENIVYTTR
KGTNVKIIEIGQSRHLTPGDQIKIQYTTAEFAAPEIHQNEMVSTVTDMWSVGVLVYVLLS
GFNPFVAETNQQMIESICNAEYSFNDEAFKHVSVEALDFADRLLTKERKHRMTAAEALNH
PWLTMNSEQLSTRSIKITRHKRYYQAMVRKEWNTVVSSARVASGGAIRSQRGVTVSKVKI
APFEHGPVAGQIKHSAADEGDDIKLICNIDNYDSTTEVTWYCGVRQLEEGTKYEITYEDG
LATITIKGITRTDDGTYRCKVVNEYGEDSAYSELFVKGVRSYREFYTTRVVKKVKRRVDT
ARLLQRPPEFTLPLCNRTAYIGEDVRFGVTITVHPEPRVMWLKTGQKIMPGDDDKKYTFV
SDKGLYQLVIHKLDPDDDAEYTVVARNRFGDDSCKARLTVIPCPAPADNTLRPMFKRVLA
NLECREGQSVRFEMRVSGHPSLKWEKDGMPLAFGPQIEVVHEGLDYYVLHVRDTLPEDSG
TYRVIATNSAGSASCQSTLKVERVTHIKKEESEEEKKKKHDLDQQEMDKKVRLTQILAGA
DVNPLTPVAQQALREAATMFKPAITTKKVKSEAEEAKEKEEKKKRAEEKRLRMPYVIPPP
RVVAPTALEEDMEIKHFVPFSDMKWYKKLRDQYEFPEPMEKFPQKRLKRIRLSRWDQFYE
VPLPRINDQYKPKWHIPVSQDDLETVRPARHRTPSPEMEAYYRIRRHSLGDLSDEELLLP
VREYLSMKRTEEERLKLEDELELGYSASPPSLSPVRFELSALRHPSPKRAAYDEEEGEEV
PTYDSYRIPSKYEAGPSYIDLRQRHDRATYRPPRQKQRLYEEKEDQELLRSVTTATKLTS
YKSQLQHIEFEEKTKVKRKEKTRVSVSAVTEAAVLTEIPTTSFSPGYATVTRPKKPSAAL
AEKEVVRTTSPEKTRPRSPSLDSTEKPDTTPDLSTKIDYMSRYESRKKALKTERKFEIVT
QRPFTLDHAPRVTVRMRSHRVPIGQNTKFTMNVQSKPEAQIKWYHNGLQIEESRKYRIFN
MSGVLSLQIIDCQEEDSGTYRVVCTNAKGEASDYATLDVAGGGFSAYASQRKDEEPPTPF
VPEMTKTDVYHVSSTKAASVSETQIEVSEIKTDKIEETIETVVQEEKVTSEIKLETMEVT
AVEEVVVEKISETKLEATEVTTVVEEVVEEKKPTLPATILTKPQSLTVSEGESVKFTCDV
DGEPAPTVTWMRETQVIVSSHRHHITSTEYKSTFEITQVETSDGGNYTVVVENSEGKQEA
QFSLTVRKPTPVQKVVASPPRVKSPESPRIKSPFGIRSPQRIKSPEPIKSPPRVKSPPMV
KSPTPKEKTSKPTFSAELKDISASADTIIKLTVKVSGEPKPSISWMKDGNNLSQGGKYEI
FEKHGSAHLEIYEADVSDSGVYTCTAKSSAGSVTTNCTVTVQVRTTTVGMERKAEMTEQI
VKKEIAFEEVQSFTEIKASKTQMTMNQGQTVTLRANIPEASDVKWILNGAQLSNSENYRY
GVSGNDHTLTIKSISHHDQGILTCEAKTEHGVVKCQFDMTVSAMRSSAPSFLVQPHSKNV
NEGQNVIFTCETTGEPSPEIEWLKDNSVISITSNMKLSRSKNVYTLEIHNATTEDSGKYT
VKAKNKFGQCSATASLNVLTLVEEPAKMIIVEKASDATSMQGSYSAKHVVSKMQETSFSS
SSMAEVKFESMSASSMTSMTSERMIAMSSSSMMALSSHSHVEGSSIKAISHGRKGIPPKI
EAAPQDISIESGKVLTVACAFIGDPTPCIEWSHSGKTLSSKAQESGRLQIETSQDVTTLV
ISGVKETDAGAYTLKLFNEFGFDTTTVNVRIRLM
NT seq 83265 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaagctccaacatttacacagccacttcagagcgttgtggcacttgagggt
agtgctgcaacgttcgaggctcaagttagtggtaatccagttccagaggtgagctggttt
cgtgatggccaggttcttactgctgcggctctgcccggcgctcagagctcgttcagcgat
ggccacgctgttctgatgatccccgctgtgacagccgcacacagtggaagattttctgtg
agagccaccaatggcgctggacaagccactagcactgctgaactgctggttacaggtaag
cagcctgtttccccttcaagactgtccgtgtcccctatcagaccagtcaagtccccaatg
actacactcaaacaagtcgcacagggtgaagatgtactgcctccatggaagcaggagggt
tatgtaggagaatccagttataccagcatgactactggggcctcatatgtccagacctcc
tccacatttgtccacaaggagcagcattgggaaggttcttttgctatgcaacaacaagct
ggtggatttgctattgttgagactgcagcaatcccatccctcacaaaagagcaagtgatg
cctccaactattgtggctggtttgaagaatgtgactgtcaccgagggagagtctgtcact
ctggagtgccagatttcaggccaccctaccccagccattatgtggttcagagaggattac
agaattgagaactcaattgacttccagatcacttatgaaaacagctatgcccacttggtg
atccgtgaggcctttgctgaagatagtggccgcttcacttgcactgctacaagtgaggct
ggaactatcagcacctcttgctacctgcttgttaaagtgtcagaagacattgaaagtcgg
gaggatttttctactgtctctgaacacattgaaatgcctgcaagacaggttacagttgaa
gccaaagaggagaccatgtctgaaataagtgctgtctccgagtctgtggaggctggagca
ggtgttgccccattctttgtgaagaaacccacagtacaaaagcttgtggagggagacagc
atagtctttgagtgccaagtcggaggaagccccaagcctcatatttactggaagaagagt
ggaattccacttactactggatacaggtacagagtagcctacaataaggacacaggagca
tgcaagcttgagatctccatgacatttgctgatgatgctggagaatacaccatctttgct
agaaacccacttggagagatttctgcttcagccatgctgcttgatgaagaggcatatgag
ctatatatgaagaaacaggaagagacattcaagaccgaagtaactactataatagaggag
ccaaaagtggctgacatacctgttgttgttgagactgtaactgagaaagagcagattctc
atgcagagaaggatggctcaacaaacccaaataatgcagtccttcatttcagagcaggag
ttacaaatatctaacttggagcaaagattcatccaagaaattgagttccgcttgctgaag
attacttaccaggagctggtgattgaggatggggagcagttggatatgagtgtttctgaa
catgatgctatttatccagtctttaatactccagttaaaagctacagactcagggaggga
atgagtgcaacttttcattgcaggatgacagggacccctctccctaagatcgtctggtac
aaagatggcaagcgtatcacacatggaggccgttatcagatggaggttctgcaggatggt
agagccagtctgcgccttccaacggtgctgtcagaagatgagggcatttatactgctttg
gtcagtaacataaagggtaatgctgtcagctctggaaagctgtatgtggagccaactggt
atagcacaaacacagcttcctcagccaggggcagttcaaagaatcaggtccacatcacca
cgctccacaagtcgttctcctggtcgatcacctgctcgtagacttgatgagacagacgag
gcccagctagaaagactctacaagcctgtgtttgtacagaagccatcatccttcaagtgc
tctgagggacagactgcaagatttgatctgaaagtagttgggagacccatgcctgaaact
tactggttccacaatggacaacaagtggtcaatgactacacccacaagattgtagtaaag
gaggatggaactcagtcaatgattgtggttcctgccatgcctcaggactctggcgagtgg
acagttgttgctcagaacagagctggaaagacaaccgtatctatgactctcactgttgaa
gccaaggaaaacttggtgagaccacaatttgtggaaaagctaagaaacatcagcgttaaa
gagggtactttggttgagctagctgttaaagcttttggcaacccccttcctgacgttgtt
tggctgaagaacagtgacataatctccccacataaacacccacatattaggattgagggt
ggtaaaggcgaagctcatttcaagattccatcatgtacaggatctgatagcgcatggtac
actgctactgctatcaacaaagctggcagagataccacacgctgcaaagttaacattgag
gtggatgcagtaatgcctcagcctgagaaaaagcttatcattcccaagggaacttacaag
gccaaagaaattgctgcaccagagttagagccactgcatcttcgctatggtcaggaacag
tgggaagatggtgacctctatgataaggagaagcaacagaagcctcacttcaaaaagaag
cttacctcagtcaggctgaagcgatttggacctgcgcactttgagtgtagactgacccct
attggtgacccgaccatgattgttgagtggctgcatgatggcaagccattagcagctgct
aacagactacgcatggtcaatgagtttggctattgcagtcttgactacgaagctgcttat
tccagagatagcggtgtcattacttgcagagccaccaacaagtttggagctgaccagacc
tccgctacactaattgttaaagatgagaaaagccttgttgaggaaacccagttgccagag
ggaaggcgaggacaaagaatagatgaaatggagcgtattgcacatgagggtggcccttct
ggagttactggagatgataatcttgaaaagactaagccagagattgtgttacttccagag
ccaatcagagttacggagggagaaacagctaaattccgctgtagggtaaccggctaccct
accccaaaagttaactggtacctcaatggactgctcatccgcaagagtaaacgattcaga
cttcactttgatggtattcactacttggaaattgtagaagccaagccctatgattcaggg
gatgtcaaagttttggctgaaaaccctgaaggtgttactgagcatcttgtaaaatttgag
attcagcagaaggaggacttcaggtcaatcttgcgtcgtgcacctgaggttaaggctcct
gctcctgtaccaacacaagagcatggtagagtctcgtttgaggttgtcaaagctgagaaa
ccatctgagacctctaaagaacccaaggaggtggttaagctgaggaaaactgagagagta
atccatgagaaattaacagaagaaacagaggagctaagaagcaaatttaagcgtaggacc
caggagggctactatgaagcaataactgccgtagaacttaagtcccgcaagaagaatgag
tcctatgaggatatgctgaagaagaggaaagaagaacttcttcatcacgcaaaagaacta
gggcctgatgctgagaggaagaaagaagaggagagtaaactcaccattcccaaagtcaaa
ccagagaaaattgtgctctctccaagcatggaggctcctaagatcatagaacggattcag
agccagacagtttgcctgggagatgaagtacacttccgctgtagagtcaccggtaaacca
gatccagaatgtcagtggttcaagaatggtgtcttattggagaagtcagaccgggtttac
tggtattggccagaggaccatgtctgtgaattagtgatcaaaaatgtcttagctgaggac
tcagcaagtataatgatcaaagccatgaacattgctggagagacctcaagccatgctttc
ctactagttcaaggcaaacaagttgtttcattcacacaacttctagaagatcagaatgct
aaagagaaggacaccatggtgacctttgaatgtgagacgaacgagccatttgtgaaggtc
aaatggatgaagaacaatgcagaaattttctcaggtgacaaatacagaatgcactctgac
agaaaggtgcacttcctgtcagtgctgataatttctatgaatgacgaagcagagtacagt
tgtgtggttattgacgatgaccacataagaaccagtgcctcactttatgttgaaggtgca
ccacttgaaattgtaaagaatcttgagaatacagaagtacctgagacatactctggagag
tttgagtgtgttttgtcccgtgaggatgctgaaggcacctggtattttgagaacaaagaa
atcactcctagcctcaaatatgttgtgtctgcacgtcgtggtcgtcatagtctttctgtg
aaagatgttaggaaggaggaccagggaaaatacactttcaaagtgggagatcttaagaca
agttcctcccttaagatgaaattgcgccctgtgactctgatgcaaggtctttctgacctg
acaatctgtgagggtgatattgcccaacttgaggtgcgattctctcaggaaaatgttgag
ggctcatggatgaagaatggccaagccatttctgcttccgataagattcacttggtcatt
gacaaagtcacccataagcttctcattgaggatgccagtaaggatgatgcaggaatgtac
tcatttgttgttcctgctcaggacatttctacaaatggaaagctaacagttcaaactatt
ggcttcttggcgccactaaaggatgtttccacagtggaaggcactaaagctgttcttgag
gctaaaatctctgctactgatataacttcagtgaagtggtttcacaacgacaagctggtg
acagcaagtgatagagtccagatggttgtcaaaggatctaaacagagactggctattaac
aggacctacgcatcagatgaaggacagtataaactgattgctggcaaagtagactcaacc
tgtaaactttctgtccagcctatatctattgttaagcacatggaagagcgtgtttgcact
gagacccagaatgtcacatttgaagtggaggtatctcatcctggcattgatgctctctgg
actttcaagggtcaacctttaaaggcaggtccaaagtacaacattgagagcaaaggtaca
cactatagcctcactgttttgaatgccatgaaggatgaggaaggagagtacatgtttatg
gctggtgagaaggaatctagagcaagacttattgtatcaggtggtgctataaataggcca
ctccatgatgtgactgtagcagaatcccagactgctgagctggagtgtgaagttgctaat
cctactacagaaggcaaatggcttaaagatggtcaccctattgacttcagcgataatatc
atgagtgaaaataatggtgctgtcagacggcttgtcatcgtcatcaccaggccacaggat
gttggagagtacacctaccaggtggcaaactccaagacatctggcaacttgaaggttgaa
gctgttaaaatcaggaagacaatgaagaaccaaactgttactgaaacccaggaggcagtg
ttcagtattgaacttacccatttagacgtgaaaggatcccagtggatcaagaatggtgtt
gagattcaaccaagtgataaatttgagataactgtccaaggcatggttcacaccctgaag
atcaagaactgtaacacccaagatgaatcagtctatgggttcaaacttggaaaactctct
gctaatgccagacttaatgttgaaactatcaaaattgtgaaaaaaccaaaggatgtgacg
tcactgctgggtgccactgcttcatttgagctgagtttgtcccatgatgacatcccagtt
cagtggatgttcaataatcaggagcttccgccaagtacaaatattaaaatactgtctgag
aggaaagcccacaaacttatcattcagagtgttgaaggtcgcatggcaggtgaatacatt
gctgtggttgggcatctgcagtgcagtgcacatcttcaagttgaatatttgagagttacc
aaacctatgaagaacattgaggttccagagacccatgtggcaacgtttgaatgtgaagtt
tctcatttcaatgttccatcgatctggctgaaaaatggagttgagattgagatgagcgag
aagtttggcattgtggtgcacggcaaacttcatcagctgaaagttatgaatgccagtcag
gaggatgcttcagaatacacatttgtgtgtggaaatgacaaagtgtctggtaacctgact
gtaaaaccaattctgatcacatccatgcttcaagacctcaatgctaaagaaaaagacacg
gttacatttgaggtgaccgtcaactatgaaggcatcatctacaaatggctgaagaatgga
gtagaaatccgatccagtgatagatgccaaactcgctgcaaacagttcactcactccctt
actattcgaaatgttcactttggggatgggggagactacaagtttttggctggatctgct
gaaacatctgcaaaactctttgttgatgctcgcgtgattgaattcaccaagcacattaaa
gatatcaaggtaactgagaagaaggctatatttgaatgtgagctctctgaacccaacgtc
cctgtgatgtggatgaaggatgggcaggaacttgagatgtctgagagattcaaagccacc
actgacaaattcctgcagcgtttgatgatccagacagtgcgcatgtctgatgctggagaa
tactctgtggttgctggtgcaagcgtttccaaggcaaacctcatagtggagggcaaggat
gtccgcatctctgagcctgctgagaaggacatcactgtggttgagaaacagagggctaca
tttgaatttgaagtgaatgaggatgacattgaaggccgctggctgaaaaatggtgttgaa
attcaatcttttgatgagcgcttcaactatgtgacagttagaaagacacatcgcttgaca
atcactgaaacttacagaagtgatgctggagaatacactttcattgcaggaaagaacagg
agcacagtcaatctgcatgtccagatccccgagcctcctcagatcatcagggacatggag
cccttgtctgttgaggctggcaaacctgcacgtttctctgtggaagtgacaggaattcct
cagcctcaggtatcctggtataagaactctcaggcactatcttctgggttcaagtgtaag
ttcctgagggagagaaatgagcacacattgctgcttatcgaagtcttcccagaggatgca
gctcagtacacctgtgaagccaagaatgactatggagtagccacaagctctgcttcactt
aatgtggaagtttcagaagtggtttctccagacacggtggctccagtttctccaccagta
attattacctcattgcaaaatacctctgctgaagagggagaatcagccagattccagtgc
cgtgtctctggagatgatctgaagattacctggtacttcagagataaggaaattgtgcag
tctgacaacttcagaatctctcagtttgatgatagctgccagcttgagatctccagagca
tatgttgcagatgcaggagaatacacatgtgttgcacgcaattctgggggaatggtctct
tgctctgctgttttgaacgtcaatgatctcagtgtgagaacagtaggtaggcaaagtgtt
tcgagcactggattgactcattcggagatggtctcctcccagaccatgagtgagacttat
tcttccactatgcaaacttttgaaagtgtctctatggtgatgatgtccacaacgtctgtt
aaaagcattgaggtccaacaagttacctctgtggaagaatattctacaagccccactctg
accctgaaaatgaatgatgtcattgtcagcctgggtgatgtggctcagttcaactgttcc
ttcagtggacaaccatttactgaaattatctgggatcataatggaaggacaataacaaat
acagaaagggtgcagtatgtacatcaaggcgggctcatttctctcatcatactcaatgtc
catcttggggaccagggaagttactgctgtactgttaaaaatagaaaaggtgaaattcga
acgtctgcacagctcacagtggaagctaaagaagcgaaccccgaagaaaccctcgtaccc
tccaattctatcagtaaatcttctaaaactgaaaatgagtcaagtaaaaaggccactgac
caagaaaagcaggagtccttacagaatgttggagccctgacaacaaagtggcagataagc
cgacattactatcctgatgttatccctttgttggagcgtgacatttatgatgcaattcag
ccagactttcttgtgaagctgtccccagaattccttgccaaacaaagagagagtgtttct
ctttattatgtaatcaaaggaagcccctctccattcgttctatggctacacaaccagttg
aatgttgaagagccaaggtcatactccttgaaacatgatgggcccttgtgctgcttaaat
ataaagaatattggttctgagcaagggggcacacattcttgcaaagttatcagtgctgca
ggagacaaaacatgcagcactcatctcagagtggatgttgtaaagcctagagaagaggtt
cctgcccgaatacatcttcactcagtgcagtcgaaaaccactttatgtaaagaagggtta
ctttcagtcgaaaagccagatgaacagaaagccatccagagacgagaaaaaaaacgtaaa
ttggtagccactaaagaagaccgtgtagaactaatttcggattatgccaaaggtcttgat
gtgatggtagaaggtcttaagattgagcacaaaacagaacccagacccttgagtgttctt
caggtagtctcacagactgttccgctttcgaaggaaaggcctctggtcagtgaagtcaag
ccgcatagtgcaattgtgcagaaagaggattggtggaataacatgcatgcagcatctgtg
tcagaatctcattcaatagaagagggtctcacagacagtttcaaagcagttgagaaattc
acttgcgagacagatgtagaaacgaaagtactggttcagtctcttcatgtagaagaaaaa
gccatatcaatagaaacttgtgtttctcttgaagctgcagagcaagactttgcagttcag
attcaagaaggtcagtctgtaaggcagtcagtactcatggaggaaaaacatactctgaca
ggtgaaatgtctcagggatttactagatcagaggcaactaaaataaacattacaactcag
ccactcgaacctcttttagtaagtgaatcgcaggaaagcaaaactcttccaaaggaactt
acctttgtaattcctgtaccgaaatcacacagcttggacatcaaacaacagttggaaatg
acacttcgatgtgctgtggcttgtgagcagtctttgcttttggcagatgtagtgaaaaag
ttagaagtcgtagaagtaaaggaggtcaaggtgcgtatggaaccgaaatacatgatgttg
acttaccttataacaacagctggtccacccatagaaattacaattgccttcgaaggtgaa
tatgcccagacagcaactcttaaaaatgagcttcatgcagctttctactctgttnntaat
caggagaaaccagtcttgacctctgaacagtcaaacatcttaaaacttgatagacctgag
agattgcaggttagcaaagccactccatatccattgtcctcggcagttttaacagaaaat
gttgaagtgtttgcaacacccaaaatgcagtctgctgctctgcaaacagaagctgaagtc
tctttccagtctgcaatatctcaaacgaaaactgctatccaggagtcaaggcaccatgtg
actcagaagactgttgaatccaaaatggacatttatagtttcgctgagactgaacacagg
gaaattaaaactgtttcagctgaacattatgagagagttgtctgtgtttcagatattaca
gttgatgcccctcacaggaaagtcactgtggaagagcctatggatgttcttattcaagaa
gacaaacgagaggttttaacagaggacgttttgactaagcatttgacagaaaagctcttt
tttgaaataccattaaaagacattactgcagaggagaattccaaggttacattgtctgtg
agagtaaaaggtgtaaaaagtgttaactggctttccaatggagtattgatcaaatctggc
aaagagttcaaatgtttaaaggatcatgactcttacacactagtaatcaacaaagttatc
aagatgaaacatgaaggtgaatatacctgtgaggctgtgagtgaagctggcaagatatca
tcatcatcatcaaggctcactgttgtctcaagagagcctccagttttcaagaagaagatt
tgtgacatgcagagcaacatcggcagcccagtgaagtttgaatgtgaaattgaagagaca
ctaaatgtgacctttaagtggttcaagtctggctcagagattagacagagtgacaaattc
aggatcatcagcaggcaaagtacatcatctctagagctcctcaacccaacaaaggatgac
gttggtgaatacagctgtcgcgcttcaaacaagcacggtagtgacacctgttctgctaac
ctgaacttcactgcctcagagcctgcccgctttgtgaagaagttgacagacttatctatt
ccaatgagcaaaaaactaaggcttgaatgcacatttaccggagctccaaaaatgtttatc
acttggtacaaggatggcaaacagctctatgcttcatatcgatacaacaccaaagttaca
tcaaactcctgtatcctggagtgtctgcatgagtgcaacaatgagactacaggaagatac
tcgtgtgaagtttcaaacgtttatgggacggatatatgtcatgcacaagtagtagcagtt
acagaacctgcccactttgtgaagaagttgacggatctctctattccaatgagcaaaaaa
ctaaggcttgaatgtacgttcactggagctccaaaaatgtttgtcacttggtacaaggat
ggcaaacagctctatgcttcatatcgatacaacaccaaagttacatcaaactcctgtatc
ctggagtgtctgcatgagtgcaacaatgagactacaggaagatactcgtgtgaagtttca
aacgtttatgggacggatatatgtcatgcacaagtagtagcagttacagaacctgcccgc
tttgtgaagaagttgatggatctctctattccaatgagcaaaaaactaaggcttgaatgc
acatttaccggagctccaaaaatgtttatcacttggtacaaggatggcaaacagctctat
gcttcatatcgatacaacaccaaagttacatcaaattcctgtatcctggagtgtctgcat
gagtgcaacaatgagactacaggaagatactcgtgtgatgtttcaaacgtttatgggaca
gatatatgtcatgcacaagtagtagcagttacagagcctgcccgctttgtgaagaagttg
acagacatggctatcccactcagtcagaaactgagacttcagtgtacattcactggagca
ccgaaaatgtttgtcacatggtacaaagatggaaagcaactgtacgcctcatacagatac
aacacaaggatcattgacaacacttgcgtcttggaatgcctccacgaatctaacaatgaa
acacccggaaaatactcttgtgaagtatcaaattcctttggcactgatatctgtcatgcc
aatataactacagttacagaacctgcccgttttgaacagaagcttaaggacaaaaaagtt
gccatgagcaaaaaactgaagcttgagagcacatttactggagctcctaaaatctttgtc
acctggtacaaggacggcaaacaaatatatgcctcttacagatacaatactcaagttgtt
ggaaacacctgcactctagaatgtctacatgaatgcacaaaagacactcctggtatatac
tcctgtgaggtgtccaattcttatggaagtgatatctgtcatgctgaagtgaccaccgtt
tctggacctgctcattttgtgaagaagctcacaaaccagactgttcagtggggacaaaag
ttgagacttgaatgctccttcacaggaattgaaaaactgtttgtcacatggtacaaggat
tacaaacaggtctatgcttcatatagatgcaacacaaaagtaattggaaacacttgcatt
ttgaaatatctccatgagtgtgatgaggatactcctggaaaatattcttgtgaggttaca
aatgaagatggatcagatatttgtcatgcgctggtcacctttgcgacagagcgcaaaatt
ccaccaactttcactaagaaaccctccgagcacattgaggatgccgagggaaaattgttg
aagcttgagggtcgagtatctgggtcacagcctctatctgtaagctggtataaagataat
agcgaaatcggcacttctgacatctatgacatttccttcaagagcaacacagctgtgatg
tgtctcaagaaagccacagtcacaaacagtggtgtttatacatgcagcgcttctaatgaa
gctggcactgtctccttccaggtggtggttaacatcacagagcaaaaaaggccaccgact
tttgacattccccttaaacaagtgacagtgagtgagggagaaaggctaaaccttagctgc
catgtctgcgggtctcccccaatgaagattcagtggatgaaggacagaagggaggtcaca
tcctctgctaacaccaagatgatatttgtggatggcacagccaccctggagataaaccag
acatccaaaactgatgcaggagattatctgtgcaaggcaaccaacagtgctggtagtgaa
ttctccaagaccaaagtcacaatcaaagataaagcaggtgcagcacctgcaacagcaccg
gcagcccccacagcacctcaaacagttaaacaacgggataacttgttcttcattgaggag
cccaagagcattcatattgttgagaagggtacagctaccttcattgctaaagttggtggt
gatcccattcccaatgtgaaatggatgaagggcaaatggagacaaatgactcatggtggt
cgtgtcaacattcaacaaaaaggccaagaggccaagttggagatcaaagaggtgaccaaa
tctgactctggtcagtacagatgtgttgcttcaaacaaacatggagaaattgagtgcagc
acggacttgaatattaatgagaagaaagagtccagaccagaggtggtcaaactgaagaag
actccatcaaagcagaaaagtccaaaggaagacaaagacattgacattgttgagttgcta
agaaatgtagatccaaaagagtatgagaaatatgctcgcatgtatggaatcacagacttc
cggggtctccttcaagctattgagtttctgaagaaggagaagggtgaagaaagtggaaga
ccggaaagtgaacatggaagagaatatgatgaggatttggctaagcttgtgtctgatttg
cagaggcgaatggaacacagtgaacctgttaccctgcttaaagacatcatagatcagaca
acgcaagttaacaaagaggcagtgtttgagtgtgaaattaaaatcaactatccagaaatt
acactgtcttggtataaagatacacagaagctagaaactagtgataaatatgacattaaa
ctcgtggacgactgtcagatattgaagatcaagaactgtcagaccagtgaccagggaaat
taccgtgtcgtttgtgggccacatatatccagtgccagactgacagtgttggagagtcaa
gatcatgtgcagaaaccatcacctgctgatcaaattcaattcaccaagcgcattcaaaat
attgaggtgaatgagcgtcagtctgccacttttgagtgcgagttgtcttttgacaatgcg
gtcgtcacctggtataaagatgcatgggagcttaaagaaagcccgaaatataccttcagg
tgtgagggacgaaggcactttatgatcatccataacgtaacgtctgacgatgaaggcgtg
tactctgtgattgcgcgcctggagcctgttggtgaaactaaaagtacagctgagctttat
ctgtcaggaaaagaatttgaaataagaacatgttcttttgatgttccagatacatcgata
catgtgccagatgtgtcatctgtgattagttttaaagaagaatcttcagaatttcattat
gaagagaagtttgaaataacagagtgtcagaactggacagttcaagcggagaatgttact
tatggattctcttcactgcaagaattgaagaaacccattgaggagactgtaacgaaacat
gtagtgaaaaggacagaggaggtccctatgaaagttatgaagcaaccagaagagaaaact
gaaacatcctttgtacagcctccagttcctgagaaagaacctgaagtcaagaagcccatt
gaggaaaaagtcacatctgtcaaggtgacagagcaaaaagaacaacccacacgcaaagaa
actaaacctcaggtgccagcagaaccaaaggctacagtggctgaacccaagtctgagcca
aaatctgagccaaaagctctacccaaacctgagcccaagtctgagccaaaaactctaccg
aaacctgagcccaagcctgagccaaaagctctacccaaacctgagcccatgcctgtgccc
aagcctgagccaaaaaaagttgaggcaccttctgtcaaagcacctgaagctccaaaaaag
ccagaagctgcacctcaaccatccttagatattaaaaaagatgaggctttaactccaaag
ccaggcactactcaaataaaagcttttgtggagatcaaggaaatagaagcaccaaaagta
aagctagaaagaaaaccagagcctgcacatgctgccactgagccaccaaagaaagacgtc
tctacactactaccagatgaatctatcaaagatcatttgcctgtccactctgagccatca
agtgtagagccagctagtcagcttaaaactacacaaagccagcctcctgaaccagttaga
aaacaagtagtcacagcttcaccagaagttatagttgaacaaacaaggaaacaacctccc
caagaagttttcaaagcagagccagagtcttcagccaaaccttcagagccacctcaaaca
gatcaagctaaaaagcaagtgccatcaaagagtgagccaacccctaaaatcagtgagcca
gcacttgctcacaaaaaggaggtggttgaagtaaaggctgcagaactgccatctgagaaa
aagcctgtgactaaagctaacatggagactgagattccctcagccaaagtctttgcagct
tctgagaagaaaactgaccaatttcctcatacagtggaagtaactcagaagatttccatg
gaggaaatgtttttgaaggaggaaattgtggaagagagtgaaagcgtgcctcatcaactt
gaggaaattttgtcttatcaagagcatattataaggatggatgtgagtcatcacagtaga
gaatcagctgctgaagatgtaaagataattaaaacagaggtttcccagaggccagaaccc
tcttttgagctgaaaaaaacaaaggagatacctgagatgaagtggtcaaaacaagaaatg
cacactgagaaaaaggaaaggaaattagagatgtccaatgttgaaacatttccagaagct
gtggtggtacttggcattgagacacctcagaaaaggcaagacattatgccagataaaaag
aaaacatctgaagatatgcctctacaaaatagagatgacagccctagaaaagagctggcc
attcagagagaaatagatgttcacaagaaagagtctattcacttacagcagtaagtccaa
aacaagcgattacatgaggaaacccctcagaaattaccagagacaacaccaataataaaa
ccagaagaaaagggaactatgttaaaggaagtgcataaagcacttgaaagagacaagaag
acccaggctgttacaacaactgattcagaagttgtttctcctgcaaaagaaccagaatta
gtgaagaaacctgaaccagaagtcccaaagccaactgtggctccagctgaacagaaaata
tcgcctccatcaaaagagccaactgttgaaaggaaaacatcacctgaggcaccaaagcca
attgtgaccccagttgaacagaaaatattacctccttcaaaagagccaactgttgaaaag
aaaccagttcctgaagtaccaaagccaactgtggctccagtagaacagaaaatagtatct
cctccaaaagtgccaactgttgaaaagacaccatctcctgtggcaccagagccaacagca
actccaattgaacaggaagtcaatcctcccacagatgcagaaaagggccctgttacagct
cctggacctgctggcaaagaaacaactagcaccacacaagcacttcttaaacaaaagagt
aaaattcacatcaagaaagaggaaaaactggacatgccaaccgtaaagaaagtaacaaga
agatcaaaagaacatccggaagatcatgaagttatatcacttaagacagttggcaagatt
ctgtgtgaagaaccaccaacagaagagggaccacttctccggaaagttgagaaaactgaa
atagttggagaggagatggtgtattcaaaggctgttactgaaatcaaactcaccagcagc
tatgaagtcacagaagatacttggtcatatgaaactgctacaaaaacagagaaaatatct
aaaggggagaaaaagaagacagaacaatacaaggatgtgaggtctcccttacaagggaaa
acgattgctcctgaaattggtggaagagaagtagaaaataagggtaaacaaggaagtaaa
attccaatggaagatgaacctaagatacctctgaaaaaggcaactaagtcaatatcaact
gagaaagaacaggaaactgtcaaattaaaacctgtcgaaaaattagataaggttgttgta
ggtccccagaaagacagcaacatagacaggagcaaagatggtattggtgtccaaaaacat
gaaaggcttataaaggatgagtctgtttcaaaaaagaaggaaatagatgcgacacctaca
gataaaaaaactaaagaacccatagttccaaaaccttttgtggctaaaggtgaaatctcc
aaagaacctgagaaatttccaaaggaagcaaagagaattctaccacatgatgagaagcca
gaaactgttactctgaacccattttccaaagaatctcatgctgatgtagccactgacatg
gttcctcaagagcaaactgagaaaaagcctgtagacattaagcgtccagagagaccggaa
acgacacatatcatgaaggaccctcacatccaggtaaaagaaccaggaaaaagtgaaaaa
acatatgaagaggctgaaaagatcagaaagctagagtcaccccatgagtatcagcccatg
aagagtactactactccagaaaagacccaggaaggttccaaagaagaggggaagggaata
actaaaaaacgtattattccaacggatgaaatgagaaaagaagaggtattgttgaaacct
gtagaaggaaaaataattgcagagaaaactccttcaccaaaggtagataaacctagtctt
caaatctctccactggctaaaaagagtccaaaagaggaagataaaccagcaatggcaaaa
caatttggtctttcaccaaaggaaatggagagagaagaggaaatatcattgaagcctaca
gaacctgcagggctaaaaaagactccttcaccaaaagtgggcatacaaaaacctaaaccc
actgaatccattccaatggaaagaaagtctagtgcaaaatcacccaagaagatttcacca
aaagattcacttgagtctgtaattctaaagaaggtctcaaagacagtctcccccaaagaa
gaaaagactactcaggaacctccctttaaaatgactgaagacaaactgccaatggtaaag
gagttgtctcctagtgttttgcatctacaaaagattcctacacagcaagaggaggtagta
tatgagcaagagcaggaggtggtggatggtgaagaagaagaaacttggggatgggaactt
gctcctagggacagttatggatccgaaacctttgatgacaccttggaggatggagctgtt
gaaaccccaggaataggtgacaagaaagatggaaaaccaaaggaggagccagctccaggc
agaggcagaggacttagaccaagacaaactccatctcctggtgatgctggaaggggtaga
gggctgaaacctggtggtggaggtgacaagcctccaggagaatcaccatttggtttccag
ctcaaagctgtccccttgaagtttgtgaaggagctccaagacattgtgttacaggaggct
gagtccattggctcctctgctgtatttgagtgccagatctctccatctactgctatcacc
acctggatgaaagatggaagcaatctaagggagagtccaaagcacaaattcacatctgat
ggaaaagaccgcaaactggctatcattgatgttcagctttcagacactggagagtacaca
tgtgttgcaaagcttggcaacaaggagaagacctcaacagctaaacttgttgtagaagaa
ttacctgtgaaattcacaaagaatctggaagaagagacctccgtgcttaagggccagcca
atgtatttgacctgtgagttgagcaaggacagagatgtggtctggaagaagaacggacaa
gagataaaggaaattcctggcaaaattcaaatcaatgttattgggctacagcgtgccatc
acaatccaggatgcgaataatgatgatgctggtgtttacacatgcgagtgtgaaaacatc
aaaactcaaactaatgtcaaggttattgaaattgttagagactggttagtgaaacctttg
cgggaccagcatgtgaaacctaaggccactgctgcattcaaaggcgagctcttcaaggac
acccctaactggaagtggtacaagggtaatgatgaaatccctaatgagcctacagataag
actgaggtgaagaaggagggtaaagatatctctcttacaattaaaaatgcccagcctgat
gacgtcgctgagtacgctgtggaggttgaaggccgcagatatgcagcaaaactaacactt
ggagagcgtgaagctgagatcttgaagcctcttgctagtgtagaggtggttgagaaaacg
gaggccaactttgatactgaaatttcagaggatgatgtgcctggagaatggaaacttaaa
ggacaggttctgacaagatcaccgacatgtgacatcagatctgagggaacaaaacgattc
cttactatcaaaaacattcagcttgatcaagctggtgaagttacataccaagctctgaat
gctgtgacaagtgctatgctcacagtaaaagagttggaaatggagttcacagtccctttg
aaggacgttactgtgcatgaaaagaaacaggcaaagtttgagtgctccatcaataaggat
gtgcctaaagtgatttggcttaagggttctgatattgttacacaaggaaataagtatgaa
atcattgatgacggaaagaaacacatactcattataaataactgtggctttgaggatgag
ggtgaatacagtattgaggtcttgggcaaatcatcaaaagcaaaactgatggtagagggt
atgaggctgaacttcacctcaacattaaaggacctaactgtgaaggaaggtaaaacagct
ttatttgagcttgaactctctcatgagaatgtcgccgtgacatggtacaaaaatgaaata
aaagtannacatacactagaaattaaggaagtatcactagatgatacttgcctaataaaa
gcagaggctaaaggaatatccacaatggctaaactgctcgtaatagagggtgatgcaaat
ttcaccaccaagttgcaagattacaccgcagttgaaaaagatgacgtcacatttgactgc
gagctcagtagagatgttcctgtgaaatggttcaagaatgaaattgaaattaaagcctcc
aagatggtgaccatgaaagttgaaggcaaacgaagaatactcaatcttaagaaagttgag
aacaaagacaaaggattatatgtttgcgactgtggaacagacaagactttggccaacttg
aacattgaagctcgtgacatcaaagtggtgcgacccatgtatggcgttgagctctttgat
ggtgagacagctcgttttgaggtggaaatctctgaagatgatgtccatggccaatggaaa
ctgaagggcgaagtcttgtcctcttcacctgatgttgagattattgaggatggtgcaaaa
cacacattaacactctacaactgtaaagtttcccaatctggagaggtggtcttccaggga
gcgaatgctaagtgttctgtaaatcttaaagtgaaagatttgcccatttcttttgtcatg
cctttgaacgatgtacaagtctatgagaaagatgatgcaagatttgaaattgaactgtca
agagaggctaaggtcgtccgttggctaaagggatctcaggagttgaaggctgacgaaaag
tttgaaatcctcacagaaaggaaaagacacattttagtggtcaaatctgctgcctatgag
gatgaggctaagtacatgtttgaggctgaggacaagaggacatcagccaaacttgttatt
cagggtatccgtcttgagtttgtcagacccattaaagatgtcaccgttaaagagcgtgag
actgcagaattcaggattgaactctctcatgagaagattcaagtcacctggtacaagaat
gatgtgcgtttgcatccaagcaaagtggtgcacttgtctgaggatggcaagatccatact
ctgtccttcaaagaggtgtctattgatgacacttctctaattaaagttgaggcccttggt
aaaagctctgaagcaatgctcactgtgcttgagggagaagcttacttcaccaccaagtta
caggactacactgcagttgagaaggatgaggttgtcctgatgtgtgaagtgagcaaatca
tctgctcaggttaaatggttgaaagacggcaaggaaatcactccctctaagaatgtcctc
atcaaggctgatggaaagaaacgtatcctgacggtgaagaaggcagagaaggccaacatt
ggtgaatatgtgtgcaactgtggctctgacaaaacagctgctaagctcaacattgaagaa
cgtgatattaaaattgtccgtccactgtacagtgtggaggtcacagagacagagactgct
cgctttgagacagaaatctctgaggaggatgttcatggtaactggaaactcaaagaagat
gccctgcaccagtctgccgactgtgaaattaaggaggaaggcaccaagcacatgcttatc
ctttacaatgttcgcatggatatggctggtggtgtggacttcagtgctgctaacgctaaa
tcaagtgctcagctcagagttaaagcacgcacaattggcctcctgcgacctctgcgggat
gtcactgtcactgctggagagactgctacctttgactgtgagctctcatatgaagatatt
ccggttgaatggttcgttggcccaacaaagatagagccaagtgacaggtctctcaatgat
gttgaggttaaggagaaggaatctgctaagtttgaatgtgaagtgtcccgtgaaagtgcc
aaggttcgctggttcaaagatggagctgagatcagaaaaggcaaaaagtatgagattatt
gccaagggattacagcgtattctcatcatcagcaaggcagtatttgatgatgaagcagaa
tatgaatgtgatgcaaggacatccaaatcctctggaatgctgacagttatcgaggaggaa
gctagattcacaaagaacctgtccaatgttgagggcacagaaaccgacagtattaagatg
atttgtgagatctccaaacccagtgcagaggttacatggtacaagggtgaccaggagatc
ccagagggtggtagatatgaacatgttgcagatgggagaaagagaattctcattatacag
gacctgcgtatggatgatgctggcgagtaccagtgcaaactgcctgcttcagaaacaaaa
ggaactctaaagatcagtgaattggcagctgagtttattgccaggccccaaaaccaagag
gctgttgagggtgaaaaggctgagtttgtttgctcagtgtctaaggaaaattatgaagtc
aaatggttcaaaggagacaaagaaattacaactgatgataagtatgaaattgttgttgat
ggcaagaggagggcactcattgtcaaaaactgcaaactaaaagatgagggtgcattcact
gcccacattggctctgtaaaggcttcagcagacttgttggtgattgaaaaactgaggata
atcacttccatcaaggatacccaagtaaaggaaggacaagagattgttcttaactgcgag
gtgaactcagagggagctaaagccaaatggctgaagaacaatgagacaatgtttgagagc
agcaagtttgtcatggttcagagagacactgtgttctctctgagaataaaagctgcagag
aagtcagataaagccagctataccattacactgactaaccaacgcggagagcaggacaag
tgctctgctaacgtcaatgtactagaggaagccctcaagatcattgagccactagaggac
tgtgaaatagaggaaaagaagaccattactttcgcttgcaaagtgaacagacctaatgtg
acagtccagtggatgaaggccggtcaagagatcactttcagcaaacgcattctgtatcgt
gtggacaaggacaagcacgctctgaccattaaggactgcagccttgcagatgagggtgaa
tacagtgtagttgctggcacggataagtccacagcagaactgatcatcagtgaggcaccc
actgacttcaccgctcagctccgagaccaaaccatcactgaatttgaggatgccgagttc
acttgcaaattatctaaagaaaaagcccatgttaaatggtacaggaacggacgtgaaatc
agagaaggaccaagacatcatatggaaaaagatggaaaagaatgcaagcttgtaatcaaa
gagtgcagaccagatgatgaatgtgaatatgcctgtggagtggaagacaaaaggacaagg
gcatgtctctttgttgaagagattccagtggaaattgtcaggccacccacagatgtattt
gagcctccaagatcagatattgtgtttgaggctgaactaaataaggacagagttgagatc
aaatggatgaggaacaacatgatcattgtccagggtgacaaataccagatgatcagtgag
ggcaaagttcatagattgcaggtctgtgagatcaggccccgtgatcagggagaatacaga
attgttgccaaggagaaggatgccagagccaagcttgagcttgcagctattccaaagatc
aagactacagatcagaaccttgtaacagatgctggaaagccttttgtcatgacggtaccc
tatgatgcttatcctcgtgctgaggcagaatggttttaccatgacatcagcctacctggg
caaaacattgacacatccaatgaaaggacagagtacaggctgaaggaccctaagaagtca
gaccagggtcgttacaagattgtcatcaagaacaaacatggaacaggagaggccttcatt
aatctcgatgtcattgatgttccgggacctgtgaagaacctgcatgttgttgacactgct
gatggtgaggtaagccttgcttgggaagaacctgaaagtgatggtggaagcaagatcttg
gcttatgtggttgagagacgagacgtcaaacgcaagtcctggacaatggccacagaccgt
gccgacattccagagtactgtgttggtggattgcagagagacaacatgtatttcttccgt
gtatgtgctcgcaatagagttggaaatggagaaactgttactactgatgaggctgttcaa
gccaaaaacaaatttgatgtgcctgatgcacctcagaaggttatggttggagttgtcaat
aggtttggtgccacagtttcctgggaaccaccactttttgatgggggatctgagatcaca
tcttatatcattgaactacgcgacagaacctctgtgaaatgggagcctgttatggtggtc
aaagctgaggatcgcacagccacactcaatgatgttgttgaaaacaaggagtacatcttt
agggtcagagctgagaacaaagctggaattggccagccaagcgctgccacagatccagtg
aagatcatggatcccattgagaggccaagtccacctctgaacttcaactacacaaatcag
accaaagactcagttcagctgtcatgggaaacacccatcagcaatggaggtagtatgatt
acaggctacatcattgagaagtgtgaggatggttctgacaagtggctgagatgtaacgct
aggctttgccctgacctttactacagggtttctggacttaagtttggtcagaagtatcac
tacagagtatgtgcagaaaatgctgctggcatttctgatccagctgatgcaattgggcca
cttttggctgacgatcctcatgtgggtcccaccatggacctcagtgggttcaagaatggt
ctggaagtcattgttcccaatgctcttgtcatccgagttcccattacgggatatcctgtg
cccaaacccaagtggacatttggtgacaaagtgctcactgcaggtgaccatgtttccatg
gttacaaagcctacatacaccgaactgattgttgctccaagtgtgcgtccagacaaagga
acgtacacattacaattggagaatgatgtgacatctgtctctggagagatcgaagtcaat
gttattgcatgtccaagtgcacccaaagacttcaaagttgcagaggtgaccagacatcat
gtgcatctaatgtgggaagcaccagattatgatggaggcagccccgtaagtgggtacaat
gtagagaaaagagaggtttcccgcaagacctgggttaaggtgatgtcaggcgtacaggac
ttcgagtacactgtcacagatgtcattgagggcaaggagtacctgttcagtgttattgct
tgcaacaaatgtggaccaggagagccagcatacattgatgaacccgtgaatgtgtcctcc
ccagccactgtgcctgaccctcctgagaacctgaaatggagagacaaatcagcaaagagc
atcttcctgctctgggaacctcccagatatgatggtggtgctactgtcaagggctacatt
gttgataaatgccagcgtggcactgacaaatgggaagcctgtggagatctcatacctgaa
cttaagttccaggtgactggtcttactgaaggtcagtggtatgcctaccgtgtaagagca
gtgaacagacttggagccagccgaccatgcaaggctacagatgagatactggctgtagat
cctaaagagccaccagaaatccagctggatgtaaagcttctagcaggcttaacggctagg
gctggcactaagattgacctgcctgctgatgtgcttggcaagccagagccaagagtaaaa
tggacaaaggctgaccatgtcctgaaaccagatgataggattaccatcgacacaaaacct
ggccattccacactttccattacaaacacaaccagatctgacacagccacctatatcatt
gaggcagtcaacactagtggccgtgccactgcaactgttgatgtcaacattcttgacaaa
cctggccctccagctgcttttgatatctctgaaatcaccaatgaatcctgctgtctggcc
tggaatgcccccagagatgatggtggctcaccagtaaccaattacattgtggagatgaga
cccacagataaagaagagtggcagaaactgtctgctacaatcaaacaaactgctttcaaa
gcctccaaactcattcccatgaaggagtatgtctttagagtatctgctgagaaccattat
ggcattgggacacctgcagagcatgtgcctattgttgcaaagtattcatttgatactcct
ggggcaccaaccagggttcagccttctgatatcacaaaggatgctgtaactctgacttgg
tatgagcctgatgaagacggtggaagccccatcactggttactgggttgagaggtttgat
ccggagactgagaaatggatcaggtgtaacaagctgccagttaaggacacatcgtacagg
gtgaaaggtttgccaacaaagaagaagtacaagttccgtgttttggctgagaatcttgca
ggaccaggaaagccaagtgctgagactgacccagttttgattaaagacccaattgatcct
ccttgggctcctgggaaaccattcatcaaagacattgccaagacttcagcagacctgcag
tggaccagacctgagcatgatggtggggctaagattgagtcctacataattgagcttcaa
aagagtggagctgaggaatgggttcgtgtagctgaggatgtgccaacaacagagcattta
ttgaagggtctgatggagatgcaggagtattctttccgagtcaaagccgtcaatgttgct
ggagagagtgaacccagtgacccaagtgaccctgttgtctgcaaagagagactctatcct
ccaaatgccccacgctggcttgaggtggttaacattactaaaatcaactgtgacctgaaa
tggactgaaccagatagtgatggtggctctccaattaccaactatgttgttgagaagaga
gacgtcagacgtagagcctggcaggctgtggataccacagtgaaagataccaagtatact
gtcactccactgaatgaaggctctctttatgtgttccgtgttgctgctgaaaatgcagtt
ggtgtaagcgagttctgtgaactagaggactctgttttggccaaggacactttcacaacc
cctggaccaccctacgctttgactgttgttgaggtgtccaagagacatgttgacctgaaa
tgggagccacccagtagtgatggtggaagacccataaccaagtatgttattgagaagaaa
gagaaggtaggcacacgctgggtaaagtctggaaagacatctggccctgaatgcaagtac
aaggtgactgatgttgatgaaggctctgaggtacagttccaggtccgtgctgagaatgaa
gctggagttggtgacccaagtgaacctactgttatcatgaccattgaggatcccataagt
ccaccttctcctccgcttgaagtcaagattgttgatgccagcagagagcacatcaacatt
acatggaaagctccagaaaagaatggtggaagtccagtcacaggctaccatgttgagctg
tcagaagctggaactgagaagtggatgaggattaatgctcgtcctgtcaaagagctcagg
tttaaggctgaggaaggcatcattcctgagaaaaaatatgttcttagagttcgtgctatc
aatgctattggagtcagtgatccctctgaaatttcagagggtgtctttgccaaagaccct
gactgtgcaccaaccatggatctccagacccaagacattgtaattgttgagggtgagaag
atggacgtaaaaatcccatacagagcaataccaaaaccatcaatggtctggaaaaagggt
gacactgaattaaagactgaagacagactgacattgacatgtgaactcaatcgtgttcac
ctggagcttctcaagtgtaaacacgaagatgctggcgtgtgcactgttactcttgagaac
agtctgggttcaataactggcacgatcaacgtaaaagtgatcggcctgcctggacaatgt
aaggacatctcttccagtgaggtcaccaagaactcttgcaagatctcttgggagcctcca
gaaagtgatggtggtagcccaatcttgcactatgttctagagcgcagggaagctcagaag
aagacatttttgcctgtgatgtctggagacaatgttttaagttttgtggtcaaagatctt
atgctcaatggtgaatattattttagagtgaaggctgttaacaagattggtagtggcgag
tttcttgaactccgtaatcctgtcataacagaagaacaaaaacaacgcccagacccacca
attgaggttgaaggacacaatcccatctcaaattcgatcactgttacttggatgacacca
ccatatgatggtggatgcccaatcacagggtacattcttgagaaaattgaaaaagatggt
gacagatttgaaagatgcgttccaaatctggtacctggtttctcctacactgtcactggc
ttgacggaaggaaaggaataccagttccgtgtccgtgcagagaacattgcaggagcaagt
gacccatctcgcagtacaccattgattaaggctgctgatcctgttgaaccaccaaaggta
tcactccatgtccgtattgcatctggcctcagtatcaaaaagggcgaagagattagattg
gatgcttacatatctggatctccctacccaactgttacatggctcagaaatgatgagaat
gtgaggcagccgtcagctaagaagaaatcagaaattgtgaaaaagaagaaaaagaagtct
gttcagcctgaacctgaagaagaattccatccaccacttttagatcgcttgtcattcgac
cagatcaaaaggggtgaaactgctctgatggtgcgtgatgccatcagaacagaccatgga
atgttcactattagagttgagaatccccatggtgttgcaacagcatcgtgtgaagttaat
gttcttgataagcctggcccccctgctaactttggatttgatgagatcaggaacacctct
gttgtttgcatgtgggatgcacctcttgatgatggtggcagtgagatcatcaactacata
ctggaaaagaaagacaacactactgatgagattggttgggtaactgtgacctcgacccac
aagggatacaattaccctgtaaccaagcttattgaaggaaaggagtacatcttcagagtc
acagctgaaaacaagtttggctgtggacatccatgctactctgaaccacttattgcgaag
aatcaatttgaaccacctgatgctcccaacatgccaagaattggagaagtcacttacagc
acagttgctctcagctggcatgagccaaaggacaatggtagccctatcttgggctattgg
gttgagagatgtgaagtcaacagcaaatattggaccagagtgaacaacaatcttcttaat
tcactgtcagttaaggctgagggtcttatggaaggccttgtttacgtcttcagggtctgt
gctgaaaatcttgctggcccgggagaattcagtccaccaactgaccctcagactgcaatg
gatgcaatcttgcctcctggccctcctgtaccaaaaattgttgatgtcacaaatacaact
atcgatatcagttgggtacctccattgtacaatggtggtggagaaattcttggatatcat
gttgagcgctgtctggttggagagaaggactgggtccgttgtactgagtttagatgcaaa
gaccgcaaatacacagtgactggactgactgagggagctgactattaccttcgtgtatac
gctgtaaatgaagcaggtcatggagcaccaggcatgactgaacctgttcaggccaaagag
ccagaagaggccccaggggttgagtttgatgtctctgtaaggaatggagtcatcattaga
gctggagaaacattgcgtctccctgctgttgttactggacgccctgtaccagaagttaag
tggacaaaagatgatgcagagccagacaaggaacacacagttattgagacagaaggaaaa
aacagcagtttaaccatcaaaaatgctttgagaactgaccatggcatataccagatcaca
ggtaccaacctcagcggaacaaagtctgcctccgttaaggtggatgtgatggatgtcccc
ggaccagtggttgatcttaagacagttcatgtgaccaagaaaattatttcattcacctgg
tcagatcctctggataatggtggaagtgacatcatgggctatgttgttgaaagaaaagat
gcgaaaatgcacatttacagacaacccttagaagttgctgcttgcaaatgtgacattgtt
ggtcttcttgatggagaagaatatatgttccgtgtagtcgcaaggaacaagtatgggcct
ggtgctcctgttgaacttggacctgttttagcagtggatcctaaaggagttccatctgcc
ccagagaaattgcactataaggaaaggaccaagagcactattactttgacttgggaacct
cctcgtagcgatggtggttctccaatcagaggctactatgttgaaaagatgagacaagac
agcaatgaatatgatgttgccaatcgccaactctgcaaagacctcaccatcactctggaa
aatctgtctgagaatacgatgtatgacttcagagtcaaagctgtcaatgaggttggcgat
ggagaaccatccaaaccaatcagtgtcaatattcaggatgatgaactgataccaactgtt
aagtggttgaaattctttaagagtgatgctattattgtcaagaagggagcagctattgaa
attcctgctgaaattgttggcctacccttgcctgcatttgagtggacaaagaatggagta
gttatcgaccaacctactgagacaatgacactggaatcagaggagattaacgggcaaact
atcaataccaaaattggtattcctgaaactgtaagaaaagacacaggcatttacaagtta
actgccacaaatacccgtggagtaggtcaacgcacaatccgagtggatatcttggatcgc
ccattgccaccaagaaacattgtggtgtctgacatcaaagctgagtcctgctaccttacc
tgggatgctccagaggacaatggtggaagcgacctcactaactacatcattgagaagagg
gatgccagcaaaaagaagtctgactgggaacagttgacatgctgcgtcatagacagacgt
tatggggtgtacaagttggaggcctatggtacctaccagttccagatcaaagctgagaac
aagtacggggtcagtgatggttgtgaatcagaaaaggttgtactcaaagatccatttggt
cttcctgggccaccccagaggccaaggattattagtcactctcgctcatccatgttggtc
acttgggatcctccaaaagacaatggtggctcaaccattcaaggctactggcttgaaaag
agagagagaggagctgtatactggagtcgtgttaacagggctccagtaacaaaaccagca
gtgaggggcctggaatacaatgtgctccaccttattgagggttccgagtaccagttccgt
gtgatggctcagaatgcagctggcgttggacctccaagtgaagcaacagaatgtgtgttt
gcgcttgatccaagaaaaccaccaagtcaaccaccagcacctgaagtaacagacaaaacc
acaagcagcgtgagtctttcctggaccccaccagaaaaagatggaggaagtccaataaag
ggttacattgttgaagttcaggatgaaggttcacttgagtggagaaggttcaatacaccg
gataagttgatcctaaccaattcatacactgtgtcagggcttaaagagaataagaaatgc
aggttcagaattgttgctgtcaatgctgctggtgaatctgagccaagtcccagaactggc
gataccattgtgcaagatattctggaggaacctgtcattaccatggaggtcacagctcat
gagcttctcaattgtcatgctggaacaaccatcaatattccagccaccatctctggcaaa
cctattccgaatgttacatgggactttgatggaactgccccaacagagaaaaagaatgag
cgtcatactttgccacaggattcagaaatatcatccagtgatacaacatcagtagtgaca
atccctgaatgtaaattaaaccactctgggcgatacatcatcactgccaacaaccaggct
ggcaccaaaatcgttaaagtgcgagtgaatgtacttgatttgcctggatctcctaaagat
ctcaaaatcagtgacatcacacgtggaacatgtagactaagctggaagctaccagactgt
gatggaggtgacagaatcaagagctactttgttgagaaaaagactgttgaaggaaaggct
tggacaaaggtcaacccagcttgcgcaacacagtccttagttgtgccagacctcattgaa
gggcaagaatacttgtttcgtgtaagagctgagaatcgctttggtttgggacctcatatc
acaaccattcagcggactaaagccagagatcctattcatcctcctgatcctcccacaaga
gtcaaaatcgttgatgtgtccaagggcattgtgactctgacatggaaggcaccaaagaat
gatggtggggcacctgtaactcactacaatgttgagcgtctatggtgggatagcagtgga
aaccagcaagagtcctggagacagtgtaaccgccgtgatattgataccaccaccttcaaa
gtggaggatctccaccagggtgctgaatatgaattccgtgttaaggctgtgaatgaggtt
ggtgccagtagaccatcctctacagcaggacccatcattattaaggaccagaacaggaca
ccttctattgagcttccagaattcatggaggttgaacagggttcagatattcatattgtt
gctaagattaagggctgtccatttccaacactcacatggcagaaggctcctcctcacaaa
agtgaaaacaaggttgatgttgagtatgatgagcacatcaacaaacttgtttctgatgat
agctgcacactgctgatccagcagggcaaacgctcagatactggcctctacactcttact
gccagcaacagccttggcaccgtttccaaggaaatgaggcttaatgttctagggcgtcct
ggggctccatctgcacccatcaaatttgaggaaattcgtgctgaacagataatgctgtca
tggctgcctcctaaggatgatggtggctccaaaattacaaactacactattgagagacgt
gttgtcaacaggaagacttggatacctgtcacttgtgaacccaaagagagaatattcacg
gttgacaatctaatgccaggccatgagtacagtttcaggattagggctcaaaacaaatac
ggcgttggtgagcctcttgatagtgaacctgaagtagccagagatgtgttcatgccacct
ggccagtgtgacaagccaacactttccagcgtcacaatagactccatgactgtgaattgg
gaagagccagactcagatggaggcactccaattacaggctactggcttgagcgtaaagaa
accacatctaaacgctggaacagagtaacccgtgatccagtcaggcccatgccacttggt
atatcacacagagtcacggggctcattgatggatctcagtatttgttccgcgtgatggca
ataaatgcagcaggatgtggacctccaagtgagccatctgatccaacatttgctagagat
ccaatagctcctccttcgccaccaaccccgcaagtcatggactggactaagactacagca
gacttggaatggattccaccgttgaaggatggaggttcaaagataatgggctaccatgtt
gaatacaaaggggagggcacagaagcatgggtcaaggccaaagacaaggaagttagagga
actaaatttgtggtcactggactaaaagagaatgcattttataagtttagagttttggca
ttcaatgctgcaggtctgagtgaaccaggtgaagttgctgatgctcttgaaatgaaggac
cggataattttgccagtccttgagctggacatttcagtaaaggagaagatggttattcat
gcaggaggtgttattcgtatcatcgcgtatgtgtcaggccaaccttcacctgtgataaca
tggagcagagatgggtatccagtcccatcagaagctgttattgaaaccacatcaatcagc
tgctccatggtaattaaagattgcactagggcacaacgaggtgtttatacaataacagcc
aagaatgagggaggagaagtgaagaagtctgttattgttgatgttcttgatatccctggt
ccagtgggggcaccatttacagcagaaaaccttacaagtgattcatgcaaactgaactgg
tttttccctgatgatgatggtggatctgccatctccaattacataattgagaaacgtgaa
gctgatcgaaaggcttggacatcttgctcctattcagctggcagacaaaatgctatagta
aataatctggtgcttaaaaaggaatattttttcagagttgcagctgaaaatgcaattgga
gtaggtcctttctgccaaacaacatgtgaaattgtgattaaagatcgtattaatgttcca
gaccgtccagaagatcttgaggtgactgccatcaccaaagactatatcagtgtgacttgg
aagccacctaagtatgatggagggtctgaagtgatatcctacattcttgaggctcgcatg
attggcaaagacaagtttgtcagacttaccaaagagacactgatggataggaaatacact
tacgatggtcttcgtgaaggcgacacatatgaattccgtgtcagggcagtgaatgaagtt
ggtccaggcaaaccatccttctccactaagccaattgcatgtaaagatgaacttgagccc
cctacaattgagctggacttccgtgataaggttgttgttcgtgttggtgaaagctttgca
ctccagggacggtatactggaaaaccaacaccatctgtcacctggtcaagagatgacaaa
gaactaaaatcagatgaccacatcaagttcaaaaacactactaccacaatgtgcctgggt
attattaaagctcagcgtggacacagtggaaaatactgtgtgacagttgaaaactgtact
ggtgctcgtaaaggcgtttgtaatgtcacagttgcagatcgaccattgcctccagagggc
ccagttgtatttgaggaagttcacagagatcatatggttatttcctggaagccccctctt
gatgatggtggatgtgaaatttctaactatatcattgagaagagagatgtaaacagggac
atgtggacaactgtaacatctgccaccacaaaaacccactgcaaagtacctaaacttgta
gagggtcgtgaatacatcatgagaattagtgctgagaacatgtatggcataagtgaccca
ctggaatcagaggagatgaaagctaaagatctattcagggtacctgaggcacctgagcca
cccattgtaaaagacgtcttccatgattcagcactggtaatttggaaccgtcctcgggat
ggtgggaagcccatcacaaactatatattggagaggaaggagccctcagctaagagatgg
tctcgtgcaaccagagatccaatctaccctgctacacagtatagggtacaagatctcgtt
gaaggctgtgaatatgaattccgtgtaatggcagagaatgaaattggcactggagatcct
agccttcccagtaaacctattcttgctaaggatcccactgttaagccaagcccgcctgtt
ttgcctgaagctgttgacaagactaaagattctgtaagtctctcatggcgtgttcctcgc
catgatggtaaaggaaaaatatttggttacttgattgagtatcagaagcccggtgcaatc
gaatggatccaggcaaatgaaactcctgaatcatgcccagacaccaagttcgttgtgaca
aatctatcagaaggtggagagtttctattcagaattatggctgtgaatgcagctggaaaa
tctgagcctgcttatgtcaaggaaccagtgaaggttcatgacagacttgaggagccagag
ttgctgttagatgccaatatggcacgtgaccaccttgccatggttgggacagacatcaca
cttagtgccaaatttaagggcatgccaattcccactgtctcttggaaaaagaatgatggt
gaagttcctgctcattgtcttattgaggtcacagcaagtggaagcaaacttcacattaag
aagtgtacccgtgctgactgtggcaattataccatcactgttcaaaatgcagctggaacg
aaatctgctacttgcactgttcttgctcttgataaacctggaccaccaaggaattttaaa
atctctgaagtcacaagtgagtcagcttacctgacatggcaaaagccagaagatgatggt
ggtgccgtaatctcccactatgttgtgcaaaagaaagatgtagcagctgagaactgggtt
ccagtttgtgctgcatctaaaaagcttagccttatggctcaatatctgattgagggaatt
cagtatctcttcagagttgcagctgagaatcaatttggcaggagtgcatttgttgaaacc
accaagcccatcaaggcagttgatccactttatcctcctggtccacccaagaatctgcat
catgtgaatgcagacaaaactgaagtatggcttcagtgggagtggcctgatcgcacaggt
ggaagtgagatcaccggattcattgttgagcatcaagaagaaggttccactgactgggtg
accttcaagaccgtcagcaatcctcagtgccatgttactggacttgtggagggcaaaaca
tacagattccgtgtaaaatcacaaaatgcaattggcattagccgaccagacaccagtgtg
ccaattacttgccaggaaaaaaccttggctccaactattgaagttgatgtcaagcttatt
gagggtcttgttgtgaaagctggcagtacaatcatcctcccagcggtcatgcaaggaatt
ccaactccaacagccaagtggcaaagtgaaggaaatgagcttaaaactgagggcaaattt
aaggtcgttactgaaggaaattcaactgtcttgactattagtgaatgtgtcagaactgac
agcggagagtatggtcttactgtggcaaaccctgctggaagcaagtctgttgctctacat
gttacagtccttgatgttccatctgctccagttggtcccgtaaatatccttgaggttacc
cctgatcatatgataatccagtggcgtgcaccaaaagatgatggtggcacacctatgatg
aactatattgtagagaagaaggatgtcaagaagccttgggagccgtggtcagttgtgagt
tctggaagcacaagcacaaaggccaaagtcccacgtttagagaagggacgtgaatatatt
gtacgtgtacgtgctgagaataaaattggcattggtgctggacttgaaagtcctcccact
attgccaagcatatgtttgatccaccaggtcctcctggacaaccaacatgttctgacata
acagaaaatgctgtaacagtgtcatggactgaaccagaaactgatggtggaagccctgtg
agtggctacattgttgagcgcagggagatgactggtaaatggattcgtgtcaataaaaca
ccagtcttggatgtaagatacagggtatgtggtttgtttgagggcaatagctatgaattc
agaatctttgctgaaaatgttgctggtgtaagtgagccttcatatccatcagacccaatg
aaagctaaacgtccaattactcctccggggcctccaagtaacattaagctgaaggactgg
agcaagtcatatgcagatttggtatggaccaaaccttccagagatggtggcagccccatc
caaggctatgttattgaatgccagaaagcaggttctgcacagtgggataaaataaacaag
gatctaatcaagttttgtgcgtttagagtgcctggacttagtgaaggcacagagtacaga
tttcgtattagagcctcaaacaaggttggagatggtgagccaagagaacttacagaaact
gtgcttgccaaagacattcttgttccccctgatgtaactgttgatgttgcttgccgtgac
ctcctaacagttagagcagggcaaatcatcaaccttgtaacccgtgttaagggtagacct
gaccctgaaatcacttggactaaagatgcaagagttttagggagagataaacgcactgag
atgaacaataacttccctcttgttgagctggtaattcaggaagctgttagagctgattat
ggaaaatatgcaattcaagcaaagaatagcagtggtcaagcacaagctacaattattgtc
aatgtacttgatattccaggagcctgtcagaatttgaaggttgcttatgtgattaaagac
tattgtatggtttcttgggaaaatccagaggataacggtggcactgaaattactaattat
ataattgagtgcagacaaccaagtcaaagaagatggacagttgtttcttctgactgcacc
aaacgacttttcaaagctccacttgttgagaattgtgaatatttcttccgtgtgagtgca
gagaataaaattggagctggtccactaacagaaacaaaagcaccagtcctagctgttgat
ccagttgagaaacctggtgagccagagaacttccaaatcgctgaaatcggcaagacattt
gtctttctcaagtggaagaaaccagaatacgatggtggtagtcgtaaccttgcttaccat
attgaaaagaagcctaaagaagcagatgaatgggaacgattacacaaaggtgctataaag
gaaacctatttcatggctgacagatgcattgagaaccaaatttatcaatttagagttcaa
acaaagaatgagggaggagagagtaactgggtgacaacagctgaagttcttgtaaaggag
gaacttgtacagccagagctcaaagtcaaattggtgggtgttcttgttgttaaagctgga
gatgccgttccaattgaggcagagcttataggtaaaccacagcctgatgtaaaatggtct
aaagaaggtgacactgcagatatcaccaaaagcccaagggtacaagttgaaactggcact
aacttcacaaaattcctgctcacaaattcaagacgtggagatacgggaaaatacataatt
actgcaacaaatactggtggaacctgctctgctgaggccaaggtgaatgttcttgacaga
ccaggtcctattagagacctgaaagtgtcagacatttctgtggacagatgtaagcttaca
tgggagataccagaagatgatggtggttgtgagatctataattacatcatagaaaaatgt
gagacaaagagaggggtatggtcagttcattcagcagctattattaccaattcagctaaa
gttactcgccttatcgaaggaaatgaatacatcttccgtgtgagagctgagaacaagatg
ggtgctggccctgctgttgaaactgagtccattgttgcaagaacccaattcagcagacca
ggtgcacctgatgcaccagaggttaccaaaattacaaaagatgaaatggttgttatgtgg
tgctctcctgataatgatggcggaaaacctataactggttatattcttgagaaaaaagaa
gagcatgccattcggtgggcccctgttgttaagtccccaattacagggacacagatgact
gttacaggtttactgcctaatcatgaataccagttccgtgtcagggctgaaaatgaaatt
ggagttggagatgcaagcaagccatccagatcattaactgcaagagatccagttgagcct
cctggtcctgttagtaacttaaaggtggctgacagctcaaagacatcaattactctggca
tggacaaagcctacatatgatggaggtgctcctcttattggatacgtcgtcgagctaaga
gtcaagggaacaggcaagaagggagatgaaggctggaaaaggtgcaatgttgctgcccag
ttgatcggaacagaattcacagtctcaagcctgaatgaaaagcttgaatatgaattccgt
gtttctgcacaaaatcaggttggcttgagtcagccaactaatcttgaggaagctgtgaca
ccaagagaagtcttggaggcccctgagatcgatttggatgcagaactgaagaaaggtgtg
actgttagagctggctgcccaattagattagttgccacaatcagaggcagacccgctccc
agggtcttatggaggagaatgggaaaagataatgttgttcagaagggccatgttgatctc
attgacactatgacatttcttgttatctctgaatctactcgtgatgattcaggcaaatat
tcattgactgtatccagtccagctggagagaaggcagtgtttgtgaatgtcaatgtactt
gatacacctggacctgttgttggtcttgaggttgctgacatcacaatgtcatcttgcaac
ctcacatggtctccacctgaaaatgatggtggcagtaacatcactcattacattgttgaa
aaacgagaaattgatcgcaagacttgggcaacagtgaaagctaatgttgataacaccaca
tttaaagttaccaatctcgccccaggaacagagtattacttaagggtcgttgctgtaaat
gagtatggtcctggggtcccaagggctacagcaaaatcctatctggcctctgatcctatc
agcaagcctgacccaccacaaaaggttgatgttctggagattactaagaacagtgcaact
gtgggatgggtgaaaccaatgcgtgatggtggggctaaaattgatggctacattattgat
tatcttgagcttccaatgcctaaacctcccaagataccaatggcggctgaaggtgaggtt
gagcctggcgtagagccggtggctccacccccgcctgaacctgtggtggaggaagagaag
gaggagaaaaaggaggaatggacgccgtacacagtcgtaaaagatttaagcatctctgtt
gctggattaaaggagggaagaaaatatcgcttcagagtggcagcaaaaaatgccatggga
tccagtcttcccacagagaccagagaagcttatgagatcaaggagcagatgttggagccc
aaaatcatcatgcctgagcttgtcactgcaaaggcaggagcaaaactgagggttgaggct
cttgtatctggaaagccagcaccagcatgccaatggaaacggggagaaaataatgtagtc
ccatcaagccgtcttgctgtgcacaaatctcagaacatgtgtgtgctcatcattaaggat
gtttcaagacaagacagtggtgaatacagccttgttgctgagaacagcactggaaaagtt
gaccagactttgaaaatcatcatcagagatattcctggaccacctgagccaccatttgag
atcagtgacatagattctgatgcctgcacactctcttggaacaaaccaactgaagatggt
ggtagcaatatcactaattatgtggttgagaagtgtgatgtaagcagaggtgactgggtt
actgctctttccagctgtggcaaagctggttgcagaatcggaaagcttattcctggaaag
gaatatgttttccgtgtccatgctgagaacagatttggtatttcagacccccttacatct
gaaaggatggttgctaagttccccttcgatgttcctggtgaacctttgaactgccgcatc
aacaaggtgaacaaggactgcatgtttgtggcatgggataagcctgagtctcatggtggc
agtccagttactggatactacattgaacgcaaagagaggaacagtctcctttgggttaag
gctaatgattctgttgttcgcacaactgaatatccttgtgctggcctaatcgagggtctg
gaatacactttcagagtgtctgctataaaccgagctggtcagggaaaaccaagcaagaaa
actgagtttatcacagcaagaacgcctgttgatgctcctggaaaaccagaggtacttgac
atgactaagaactcagttacattggtttggaccaaaccaaagaatgatggtggaagcaag
ataattggatactatgttgaaatgatgaggcttccaggagacacttgggtgcgttgcaat
acaagtagtcaaaatgtgcctcgtgaggagtacactgcaactgggttagaagagggtgct
aagtaccagtttagggtaattgccaagacagcggttaacattagcaggccgtctgaaatc
actgatccgattctggtgtctgcagaaaatgtaccgccaagaatagagctttcaatacag
atgaaaaatatgttgccagtaaaggctggatcagatgtgtgccttgaagctgaagttttt
ggcaaaccaatgcccaaggttacatggagcaagaatggagaagtgttgaaggctgacaaa
gaattcaagatgtctcaaaagagacacctcttttctctgagccttgatgcagttaccaaa
cttcatatgggaagttatggaattcttgcagtaaatgctagtggttctacaactgcagaa
atgcaactcaaagttttagatatacctggcccaccagcctctatgaagtttgatgaggta
ctttcagagcagatcaagttgagctgggaggctccacttgcagatggtggttctccaatt
acaaattatgttgttgataaacgtgagacaagcagggctaactgggcccaagtttctgct
aaaatcagtggtgatacaaaagaatgtttagtggagagactgattgaggggcacgaatat
cagttccgcgttcgtgccgagaaccgctatggtactggtgatggcatcatatcggaccct
gttgttgcaaggaatcccttcactgttcctggagcatgtgacccaccggtccttacaaac
atcacaaaggagcgtatgactgtaagctggaaggaaccatctgatgatggaaaatcccct
attcttggatatatagttgagaaatgtgagaccaaggaaattaactggactaaactgaac
agaaaacccttgctggagagaacacttgaggttggaggtctctctgagggagctcagtat
gagtttagagtcactgctgttaataaagctggccttggcaaacccagtgaaccatctaat
gccacatctgctcttgatcctttgtatcctccaggcccacccatttctcccaaagttata
gacacgaccagcagcacaattagactaacttggactaagcctgcaaatgatggtggtagt
gaaattttgggataccttgtcgaaagcaagagaactaatacaacagactggataagatgc
aatgtacccaagaaccttcaggatacaaattatgttgtgactggactcttggagaactca
gagtaccaactccgtgttactgctgtaaataaagttggattcagccagccttgtgaattt
cttgaaaaacatgttgccaaggatgtttttgctgctcctgaggctgagcttgacgcacag
ctgaaggacactgtggtgctcacggctggcagtaaaatgaaacttcatgccacaattaag
ggtcgaccaatccccagggtgacctgggccaagatgaacaccaacattaaggacagacat
ggaatcataatcaagacaacagacactgatacattggtttatgttgataaagtcaataga
tatgatgcaggcaaatacattctgaatcttgacagtgtaagcggaatgaagatgtacaca
gttattgtcaaggtccttgatactcctggacctccactgaatctgatggtaaaagagaca
tcaaaggacagtgcctccatcctatgggatgcacctctaattgatggtggaagtgagatt
acaggttacattgttgacaaaagagatgcagaaaggaaagcatggtcaaatgtttcaacc
acttgcactcaaacatcttttaagattgatggtttagaggctggaagatcttactgtttc
agggttctggctcaaaatcagtttggcattggtgagccatgtgaaactgtggatgctgtt
agagcttctgaacaacctggaccagttatggacttcaagaccttgctggtaaccaaggaa
tcttgtacactttcctggaaaaagcccatcagtgatggaggaagccgtatcattgcatat
gtgctagaggtccttaatggcgaagacaaatggaaggagcttcttagatcaaagaacatg
caatatagtgcaaaggacattactgaaggaagggaatacaaatacagagttaaagcaaca
aatgattctggtgatggtcctgtgaaagaactctctgtgattgctaaagatgtcaatgtt
tctccaagctgtgacttgcgagagttgcccaacttgaactatatcgcaaaagaaggaagc
accgttcgtctcaagattcctattagtggaaagcctgtccctgttgtcacatggaagaag
ggagaggatgaaaatctcacagacacaggaagagtgtgtgtagaatcaacggcagtaaac
acaactcttatgatacgtgactgccaaaggacagatgcctcaaaatacaccatcactctt
cgcaacgctgctggaacaaaagaatccacaatttttgtcagagttgttggaaaaccagga
attccagctgcatcagtaaagttcaaggaagtgactgcagatggtgcaaccttaaagtgg
ggtgttcctaaagatgatggtggatcagaaattaccaactacatacttgagaaacgtgat
tccattactaacatgtgggttactgtgtcttcatctgtggacacaaacactttcagagtg
actggtctccatgagggaactgagtacatctttagggttagtgcagaaaacaaatatgga
attggtgagggcctcaaatcagagcctatggttgccaagcatccattcaatgttccagat
tcacctccaccccctcaagttatgagtatgtatcatgattcagcaacacttgcatggttt
gatccaaggaaaaccggaggctcaccaatcacaggttatcatgttgaattcaaggaaaga
aacagcatgttatggaaaagagcaaacccaagtgctttgaagatgagagatttcaaagtg
acaggcttaacagagggtctagaatatgagttcagagttatggctattaatctggctggt
gttggtagaccaagtcctgccactgagccaatggttgccttggatgcaattgatgcacct
ggcaaacctgatgtgattagcatcactagaagcactgtaacacttcagtggactgagcct
caatacgatggtggacacaggcttacaggctacattgttgagagacgtgatctcccagca
aaggtctgggtaaaggctaatacaataaatgttgtggactgtgcatatactgtagcagac
ttgcaagagggttgcaagtatgaatttagaatcagggcaaagaatgcagcgggagcaata
agtccaccctctgaacaaactgatacccttgtgtgcatggatgaatatgcggcaccaacc
attataattgatccaacagtcaaggaggggctaactgtcaaagctggagatactattgta
attactgcaacaagcattctgggcaaacctcagccaacctctgtgtggtcaaagggtgga
aagtatttcaagccatcagatgtgtgccaaatagaaactacaccttcttcttctactctt
tctatcaaatatgcaagtaggaaagattcaggagagtacacaattacagcaagtaaccca
tttggtgtgaaagaagaaaatgtgaaagtaaaaattttagatgttcctggtccaccagag
ccagttgaagcaagtggaatttcatctgaaaaggtcactttgacatggacatcacctcat
gaggatgggggatctccaattaaatactatactttggagaaaagagaaacaagccgtctc
ctttggaccattcttgctgaaaaggttattgactgccactttgttgccaataagcttatc
cagggaaatgagtacatcttcagagtttctgctgtcaacagttctggagctggtgatgct
tcccattctgaaccagtgaaaatggtggatagctatggtccccctggtccaccagctaaa
ccagaagttgaaaatgttggaggaaattctgttaccattgcttggaaaagaccagctgat
gatggtggaagtgatataatgggctatatggttgaaaggaaagaaaaggagggcatgaga
tggacccgagcatcaaagaaaacaattgctgaactccactttgaagtgaaagggctaaaa
gagggagttgaatatgaattcagagtaactgctgagaataaggttggttttggtgagcca
agtgaaccttcaatgccagtgaggacaaagcttgttgcagatgtacctagtcctccagtc
aacccaagggtcactgacacaacaaaaaccacagctgaattgcactggggcaaaccactt
agtgatggtggcatggaagtcacaggataccttgttgagcacaaaaaggagggagaagaa
gaatgggtgaaagatacagctaccccgttgaggatcactgagtttgttgtccccaatttg
caagctggaacaaagtataatttcagaatttgtgcaatgaatgcaatgggtgttagtgaa
ccagcacaaacaaaggatcatgttgaaattgtggaatgtgaagaaatccctgatttagaa
ctagatatagaactccgaagaacgttagttgttagggcaggtgcctctattcgtattttt
attcctattaaaggacgcccaacccctacagtgacttggacaaaagaggactcatcattg
aaaactcgtgcaatcatcgacaatactgaatcctataccctgttggtcattcccgactgt
aatagacgcgatgcagggaaatatgatttaacattagagaatgctgctggaaagaagact
gcttctgtggttgtaagggttttggactcccctggtcctcctcttaatctgaaacccaaa
gcaattgacaaagagaatatcacattggaatgggaaatgcctcttattgatggaggtgct
aaaattactaattacatcattgagaagagagagtctactcgcaaggcatatgctgctgtg
atcacacaatgtgatacatgctccatcagagttcctgatctggcagagggtttggaatat
tatttcagagtttatgctgaaaatgagtatggcattggtgaagcagctgaaaccccagac
ccaatcagagtatctcaagcaccaactccaccagaaaatgtcacttttactgatgtcacg
aagaactcagttagtcttgtatggactaaaccaaaacatgatggtggaagtagggttact
gggtatgtaattgaagcacaaaagaaaggaacagaccagtgggcccatgtgacaactgtg
aaaactttggactttactgtaaaaaatcttaatgaaaatgaagagtacatattccgtata
atggcagtgaacagttctgggcgaagtcgtcctcgtgtaagcaagcctgtagttatcaaa
gaacaaagttcagaaccagaatttgatctccgtggtgtgtgtcagaagacagttattgcc
aaggctggcgatgatataaagattgaggtgcccgtttctggacgtcctaagcctacactt
tcttggcagaaagacaatcaagccctcaaattaacacaaaggacaatgattaaaaatacc
tctacctcaactatcttgatcataaatgaatgtttaaggagtgactgtggaatatactca
atgacaggaaagaacatcgttggctcggttacagatagcatcacagtaaaagtgcatgat
gtgcctggaccaccaaagggaccaattaaactggacaaaatatctcgtacttttattgag
ttctcatgggaagctcctgaaaatgatggaggtgtaccaatcaataactatatagtagaa
ataagggaaactactagccagacatgggtagaactctcctcattgattattcgtacaaca
tttaaagcaactcgtttaacaacaggaactgaatatcaattccgcatcaaggctaaaaac
agatatgggacagggcctccattaacatcagaggcagtggttgctgcatatccatttaag
gtacctgggccacctggaacacccaaagttgtcgctttcaataaagatacaatgacaatt
ggttggaatgagcctgtttctgatggtggaagtgaggtcattggttaccatgttgaaagg
aaagagaggaacagtattgtttggcacagaattagcaaggcacttgtgattggaaatctg
ttcaaatccacaggactagaggatggtgtggcatatgagttccgtgtgattgctgaaaac
atagctggaattggaaaaccaagcaaagcttctgaaccaatgcttgctcttgatccagtg
gatccacctggtcaacctgtcccaatccatatgtccaaaaatgccatcactattcagtgg
acaaagccagagtatgatggtggattcaagattactggctatactgtggaaaagagagat
cttccagctgggcgctggataagagctaactttacaaatatcattgaaaccactttcact
ataagtggtctaacacaagatgaatcttatgaattccgtgtacttgcaagaaattcagct
ggtgcggtaagtaacccatcagacccatcagatccaattatttgcaaagatgacattgaa
gaaccaaggattatggttgatgctaaatttaaagatattgtccttgtcaaagccggagag
gtgttcagacttgaagctgatgttgcaggccagccattaccatctatggtttggtcgaaa
gatggaaaagatgttgaaaacacagccaaactacagattaaaatgacagaacttacagca
gtcttgatcaacaaggattctgtcagaagtgatggtggtgaatttattttgacagcaaca
aatgttggtggctttgctaagcatgttttcaatgtaaaggttcttgatagaccaggacca
cctaagggacctctgacattttctgatattacagctgaaaaatgtgtgctaacatggaat
ccacctgcagatgatggcggtgcaaacatccaacattatgttattgaaaaacgtgagtca
agcagacttgcttggacaaatgtggcatctgaattgcaggttaatcagtaccaagtgaca
aagttgctcaaaggaaatgaatacattttcagagttatggctgttaacaagtatggtgtt
ggagaacctcttgagtctgaagcaataattgcagataatccatatgtacgaccagatcct
ccacaaacacctgagataacagcggtaaccaaggattcagtagtcctctgttggggtgca
cctgctagcaatggtggaagtgaaatcaccaactatcgtattgagaaaagagacaggatt
agtttgcgttgggtaaaatgcaacaagaggaatgttactgacttgcatttcaaggttact
gctcttgttccaggccatgaatatgagttcagagtttttgctgaaaatgcagcaggaata
agtgaaccaagtccttcatcaccatttgtcaaggccacagatactcttttcaaaccaggt
ccccctggcaacccaagaatcctggacacaacaaattcttcaatcacgcttgcatggaac
aaaccagtttatgatggtggttctgaaattactggctatattcttgagacctgtctccca
ggaactgaagaggaagaatggacaattgtctcccctaaagatggtgtaaaggggacatca
tttacaattacaaatctaaaagaaaatcaggaatacaaaattaatgtgtccgctgtaaat
tgtgagggtattggagaagcagcacctgtaccaggttcacctaaagcagaggaacgactc
ataccaccagaggctgaccttgatgctgaacttcgtaagatagtgaacatcagagcatgc
aatacactaagactttttgtgccaattagaggtagaccaacaccagaggccaaatggtca
agagagaatgatgaacctttagacagagctacaattgaaacaacgtcatcttttacatca
ctggttattgacaatgtgaatagatttgacagtggcaaatacaatttgactgtagaaaac
aactctggagcaaagacagtctctgtaatagttagagttctagatacacctggagcacca
caaaacctaaaaataagccaggtcactaaagaatctgtttcacttgtttgggatcctcca
cttaatgatggtggcacaaaaattaagaattatattgttgagaagcgtgaggctacaaga
aaggcatatgctacagtaaatgccaattgtcacaaaactacttacacagttgaccagctc
caagaaggatgcaactactatttcagagttctggcagaaaatgagtatggcattggtctc
cctatggagactggtgaatctgttaaagtgtctgagaagccacttccccctggcaagatt
gcacttcaggatgtcacaaagacaagcgtgacattatcatgggaaaagcctgaacatgac
ggaggaagcagagtggttgcatatgttgtagagatgcagagcaaagggaatgaaaaatgg
acacaagctgtgattgtcaaggtacctgaagcagttattactgggcttgtacctggtgaa
gagtatatgttccgtgtttctgcaaggaatgaaaagggaaccagtgatcctcgtcaaatt
ggtgtgcctgtgattgccaaagaccttgtaattgctccatctgctaagatgttgttctcc
acattcagtgtcctggcaggagaagatttgacaattgatattccatataatgctcgtccc
aaagctaccatttcatggctaaaggaagcagttccacttaaacgaacaaccagagttaac
ttttcctctatggatacacagctgaatttagtaatcaaagaggcctgtagagatgatgtt
ggccagtatagtattaaactatcaaatacagctggtgagacaaaagtagacattagaatt
gtagttcttgacaaacctggtccaccaacaggccctgttaaagttgatgaagtaacatct
gacagtgttaccatttcttggcagccaccagagcatgacggaggctgcaccattaataac
tatatagtagaaaagagggacacatccacaactaattggcagattgtagcagcaaatcta
gcaagaactcaaattaaggcaggaagactgaagacaggctctgaatatcaattcagaatt
gcagcagagaacagatatggcaaaagccctctgcttgtgtctgaatgtgtggttgcacag
tacccgtacaaactaccgggccctcctggaacacctttcttgcagtcttccacaaaatat
agtatggtgatagtgtggaatgaacctgtcatcgatggtggaagcacaatcttagggtat
caccttgagcgaaaagagagaaatagcattctttggatgaaactaaacaaaagcataatt
caagacacaacattcaagacaacaggtcttgaagaaggcatggaatatgaattcagagtt
tatgctgaaaacattgttggcattgggaaggctagtaagatctcagagggctatactgcc
agagatccttgtgatcctcctggaacaccagaagcagttagaatcacaaaaaattatatt
acaattgaatggaccaagccagagtatgatggtggaagcaaagtcactggatatattgta
gaaaagaaggaattgcctgcaggacgctggatgaaagcaaacttcaccaatataatagag
actgagtatactgcaacaggtcttaccgaggatgagaaatatgagttccgtgtcattgca
agaaatgctgctggagttttcagtgatccatcatatagtactggacctatcatggcaaag
gatgagattgaaccaccacgtatcagcatagatccagagtacactcaaacaattgttgta
aatgcaggggacaacttcaagattgatgcagatattcatggaaaaccaacaccatcaatc
tgttggatgaagggtgagcaggaacttggaaacaccatatctcgtgaaattaaaagcaca
gatagctatacctgtttgactgtaaaggaggccaaacttgctgatggaggtcaatatact
ctacatctgcaaaatccaggaggagaaaagactgtacaagtcgatatttgtgtccttgat
aagcctgggccaccagagggacccatctctattacaggtgtaaccagtgaacaatgctgc
ctttcttggaaaccacctaaacaagacgggggcagcaagattactcattatattgttgaa
aaaagagagactagcagactactttggacagttgttgaacccaaagtccaagttctaaac
cttaaaataatgaaactactagaaggaaatgaatatattttcagagttttaccagtaaac
aaatttggtgttggtgagcccctccaatcaagtgcaggtgttatcaagaatccatttaca
cctccagatgcaccaaaaggagtggaagtatctaatgtcaagaaaaattcaatgatcata
acctgggaggccccaacaaatgatggaggtactcctatcactggttatattattgagaaa
cgtgacaaggaaggcattagatggaccagatgcaacatgaaaacagttactaacctcaca
tttaaagttactggactcctggagaaccacctctacgaatttagagtttctgctgagaat
gctgctggagttagtgaggcaagttctgcaactgtattctataaagccctggatcctgta
ttcaagccaggtccaccacataatccaaaagtgttagacatgaccaaatcatctgttgta
cttgcatggggaaagcctatttatgatggtggctgtgaaatccagggatatattgttgaa
gcatgtgaagcaaaagcagccatagaggagatacagactccaggagaagaaggaaaggca
gctgcagatgaatggacaatctgcactccaccaacaggtgttaaactgacacgctttaat
gtggaaaatctgaaagaaaagcaggaatataaattcagggtttgtgcagttaacaaggtt
ggtgttggggagcatgctgatgttgcagggtccatactgccagaggacaaaactgaggaa
ccggatcttgatattgatgcagagtttagaaaggttgtacgtattaaagctggaggttct
cttagaatgttcatccctttcaaaggaagaccagcaccacaaatcaaatgggaaaaagat
ggtgggcagattaaggaaacagcacagactgagaccagcagcagtcacacttctcttgtg
attgataaagtcaacagggcagacagtggtaaatacactgttactgcagaaaactctgct
ggtgcaaaatctgaaacaattattgtgaaagtccttgacacaccaagcgctcctctcaac
ttcaaagttaaagaaattacaaaagaatctgttactcttacatgggagcctcccatttta
gatggaggagcaaagatcaaaaattacattgttgaaaaacgtgagagcacaagaaaaaca
ttttctgctgttgtcacaaactgccacaaactctcttggaaagttgaaccacttcaagaa
ggctgcagttactattttagagtgcttgcagaaaatgaacatggcatagggctacctgcc
gatatcacagatcctttgaaggtttcagaggtgccacaatgtcctggaaaattaagtgtt
gtagatgttactaaaacaagtgtgtctctttcttgggaaaagcctattcatgatggtggc
agtagaattcttcaataccttgttgaaatgcaggtcaagggtaatgataaatggtctgga
tgtgccaatgtaaaaacactggaagctgtaatcagtaatttgaaccctggcgaagagtac
actttcagagtaattgctatcaatgaaaaannnnnnnnnnnnnnnnngagtgacccaaga
acacttgctgtccccgtgcaagcaaaggaccttgtctttgggcctgatgtaagacctgca
tttagcaactacagtgttcttgttggaaaggaccttcaagttgaaatcccagtttctggt
cgtccaaagccaaaggttacatggacaaaggatggtgcagccctcaagttcacaacaagg
gttaacatttctaatacagcacacagcactgttcttaacatcaaagaatcagcaagagaa
gatggtggaatgtatggaataaacgtgtccaatgttgttggacaaaaggatgccaccatt
gaaatcatcactcttgataaacctggcccaccaactggccctgtgcgatttgatgagata
actgtttcaagcgttacattgtcgtgggatcctccaaagtatactggtggttgcccaatt
tcaaattatattgtgcaaaatagagatacaacttctacaacatgggagaatgttgcaatt
tcattagcaagaacaacacttaaagtcgtacgactgaagaccggtgctgaatatcaattc
agaatcattgctcagaacaggtatggcaagagctatgctctggactcttcaactgttgtt
gctcagtatccatatagagaaccaggaccaccaggaactccatttgtgtcatgtctatca
aaggaccatatggttgttgagtggaatgagccagtttcagatggcggcagcaccattatt
ggatatcatcttgaaaggaaggagagaaacagcattctttggtcaaagataaataagaca
ctgattcaagaaacaagattcaaaaccagtcctttagaggaaagtgttgaatacgagttc
agagtatatgctgaaaatatcgttggcattggaagatgcagcaaaatctcagagggcttt
gttgctcgtgatccatgtgatcctcctggaaccccagaagctgtccatgtgactaaaaat
tcaataactattcagtggacaaagccagagtacgatggtggaagtgttatcactggttat
actgttgagaaacgtgatcttcctgaaggacgctggatgaaagcaagtttcacaaatgtt
attgaaaccaattttactgtcactgggctgacagaaggtgccaagtatgacttcagggta
attgcaaagaatgcagttggcactatcagcaaaccatcatacaactgtggacctattgct
gcattggatgaagtagagccaccaaagttctctattgacccagaatacactcagactcta
gttgtgaatgcgggagatacattcaaacttgatgctgatgttcatggtaagccacttcct
gcaatccagtggtttaagaatgacaaggagcttgaaaacacaattagatgtgacatcagg
aacactgacaacagagcattgattatagtaaaagatgcagtcagacaagatggtggaaac
tacactcttcagctcactaatgttgctggatctcagaccgttcaattccatgttaaagtc
cttgataaaccaggtccaccagaagggcctcttcatgtcacaggcgtgtccagtgataaa
tgcacactgatatggcatgctccgctagatgatggaggaaacactatcactcattatatt
attgagagacgtgagacaagtcgacttgcttggactgtggtctgtaatgattgcaaaact
acaacatacaaagtgacaaagctcctggaaggtaacgaatatatattccgtgtcatggct
gtgaacagttacggtgttggggagccaactgaggcaccatccgtaataatgaaagatcca
tttagtcaacctggatcaccacaaattatcgaagtaacaaatattgcaaaggactctatg
actatttgctggagtgcaccagatactgatggtggaagtaaaattcttggttacatcatt
gagaagagagacagatctggaattagatggacaaggtgcaacagaaaaaaagtaactgat
gtatgcttcagagtgcatggcctaattgaggatcatgagtatgaattcagagtgtcagct
gaaaatgcagctggaattggagaaccaagcttgccaacgtcatactacaaggcttgtgat
cccaaatacaaacctggctcacccatgcatgcacatgttgttgataccaccaagacttca
attacagtggcatggggaaaaccccttaatgatggaggatgtgcaattcaaggatatatt
gtagagatctgcaaagctgaagaggaagaatggactatgtgcactccccctactggctta
cgtgtcaacaaatttgaaatcactaaactaacagaacaacaagaatataagattcaaata
tgtgccatcaataaattaggtgttggagaacctgcagttattccaggaactgccaagcct
gaggacaagctggagacccctgaaattcaccttgattcagagctaaggaaaggcattgtt
gttcgtgcaggaggatcagtaagaatcaatgtaccattcaaaggtagaccaattccagat
atcaaatggactaaagacgaaggtgaactgtcagaaaagacagtgcttgaaaagggtctt
aacttcacccagctttcaattgactcctgtgatagaagggactctggaaaatacactgtg
actctacagaacagcagtggctctgtatctgaatttgtggctgttaaagtgttagataca
cctggagcaccactaaacctcgtagtaaaggatatcaagaaggactctgttacacttgtt
tgggaaccaccacttattgatggaggtgcaaagatcaagaattatattgttgacaagcgt
gaatccacaagaaaagcctatgcaaatataacaaccaagtgcagcaaaacaacttataag
gtggaagatcttgcagagggggccatgtattatttcagagttatggctgaaaatgaatat
ggtgttggtttgccggttgaaacaaaaactgcttcaaaggcatctgaagtacctcagcca
gttggaaaggtgatgctgacggatgtgacaaaagtaagtgcatctctggcctgggaaaag
ccagagcatgatggaggtagtaggattgcgggctacttgattgaaatgcagccgaaagga
actgacaaatggggtgtagcagcaaatgtaaaaacatgtgcgggaacagtcactggactg
actggcggtcaggaatatttgttccgtgttttggcatacaatgagaaaggcaaaagtaag
cccaagacccttgctgctccagttattgccaacgacctcacaattgaaccaagcctaaag
ttgcagttcaatacatatagcgtcaaatctggaaaggatttcaaacttgaaatacctatt
tttggacgtccaaaaccaaagatcacttggtcaaaggatggacagtcacttaaagtaaca
tccagagttactactttcttcacaccaacatccacaatcctgcagattactgaagcctgt
aaagatgaccttggaaagtatacagttaccgcaacaaacagtgtttgtgcagttacagaa
gatatcagtatcataatcctggataaacctggtccacccacaggaccaataaaagtgaat
gaagtgagcaacaattctgtttccatctcatgggaacctccggagtatacaggaggctgc
caagtaaagcattatattgttgaaaagcgagacaccactgaaactacttggcaagtagtc
gctggatcagttgccaggacatccctcaaaattaccaagctgaaaacaggtgctgagtat
cagtttagagtcattgctgagaacagatatggtaagagtgctcctttggattcaaagtcc
attgttgtgcagtatccttacaaaccacctggtccacctggtactccacatgtgaaatct
gccaccaaagatcaaatgataattgagtggaatgaaccagtcagtgatggtggcagttca
gtgattggataccaccttgagagcaaagaaagaacaagtattctatggacaaaactaaaa
aaaacacttattactgatactgttttcaaaatatgcaatcttgaagaaggcattggttat
gaattcagggtatatgctgaaaacattgttggtattggcagagcaagcaaagtttcagag
agctttgttgcccgtgacccatgtgatccacctggaacgcctgaggctgttacaatatca
aaggaccacattaagattcagtggacaaagcctcaatatgatggtggcagcaaagtgact
ggatatattgttgagagaagagatttgcctgagggccgatggatgagggcaaattttacc
aatgtaattgagacagaatttacaatcacaggcttaacggtaaacaatcaacatgaattt
agagtaattgcaagaaatgcagtgggtgtcttcagcgagccttcagacagcactggacca
attactgctacagatgaaattgaacctcctagtgtttcaatggatcctaagtacaaggat
gtcattgttgtcaatgctggagacgacatagttttggatgcagatatacatggtaaacca
acacctgatattcagtggctaaaagaaggaaaggaaatggataagacattgcgtattgaa
gtaagaattactcaaaaatatgcttccattacaataaaagattgtacaagattggatggt
ggagactatgaacttgtattaagtaactgtggtggaacaaaaacaattccaataacagta
aaagttcttgacagaccaggtccaccaactggaccattacgagtgactggcatcatgtct
gacaaatgtcatctgtcctggtctgagcccttgcagaatggtggagctaatatttctcat
tatatccttgagaaaagggaaactagcagactatcatggactgctgttgattctaacatt
cctagtgtaaattataaggtgaccaagctcctgccaggtgatgagtatatctttagagtt
atggctgtcaacaaatatggcattggtgaacctctagaatctgaggcaattattgcacgc
aatccatacaagccaccaagtgtgccatcaacaccagaagcaagtgagataacaaaggat
tcaataactctatcatggaatgccccagagagtgatggtggagcagaaattaagtgttat
cacttagagaagcgtgacaaagatggtgtgaggtggacaaaatgcaaccgacagaagctg
accgatctgcatttcaaagtaactggtctgtcagagggacatttctatgagttccatgtg
tctgctgaaaatgaagctggtgtgggagaatttagtgacctatctctgttttatagagca
ataaatgccacaactcccccaggtccacctcatcatcctaaagtgacagatcactcaagc
tcatctgtctctctgtcttggggaaaacctgctactaatggtggtgcatatattaaaggt
tatattgttgagatgaaagaggtttcttcagaggaatggatcatatgcacacccccagct
ggtattcaagcaacacgcctcacagttgaaagcctgaaggaaaatgctgaatataacttc
cgtgtttgtgcaattaattctgaaggagttggtgagcctgctgatgttcatggatcagtg
actgcatctgaaaagattgaagcacctgagattgaacttgatgctgacctcaggaaagtt
gtctctgttcgtgcaggtggatcccttcgtcttttcattacaattagaggtcgacctgag
ccatccgtcaaatgggaaaaggaggatgggactctaactgagcgtgctcagattgaatcc
accagttcatacaccatgcttgtaattgacaatgtcaatagatttgacagtggaaaatat
aacttgactcttgagaacaagagcggcacaaaatctgcatttgtgaatgtcagggtgctt
gatacaccaagttctccacagaagtttgaagtgaaagatgtaaagaaaaattcagtaact
ctctgctgggacccaccgcttacagatggtggggctaaaataaccaattatgtggttgaa
aagcgagaatctacaagaaaagcttatacaactgtcacaagcaactgcacacagacttcc
tttaaagttgatgaactgcaggaaggaggaattttctacttccgtgtatgtgctgttaat
gagtatggctttggtgtgatggcagaaacaaagaatcctattaaggttgcacaggtacct
atgcctccaggaaaagtaactcttgtggatgtcacgaagaatagtgtgacacttacttgg
gttaagcctgtccacgatggagggagcaaaatcatctgctacaatgtagagatgcaaccc
aagagtagtgacaaatggggtgtaagctgcacagttaaggttccagaggctactgtgagc
aacctcacccctggtgaaacatactcattcagggttactgcattgaatgagaagggcaag
agtgagcctcaagaacttggcgtacctgttgtagctaaagatattgagattgaaccctct
gttcatctgctgttcaatacatacagtgttaaggctggagatgatcttactgtggaagtt
cctgtgagaggcaggcctaagccagttgtctcttggaagaaggatggccttcctttgagg
caaacaacctctctttcaattgtcaacacgatggtgtcaagcaaaattgtcatcaaagaa
gctgctattgaacatgttggtaaatatgaaatcactcttgctaatacagcaggcaccaag
tccacagacattggcattgttgttcttgataaacctggtccaccagcttcagtgaaggtt
gatgctgtgacttctgacaatattacattgtcatgggcccctccagaatatgatggtgga
tgctccatcaacaattacattgttgagaagagagacactaacacaacagagtggcagatt
gtttcaacaaatgttgccagaacctcagtcaaagtacctcgattgacacagggttctgag
taccagttccgcatctatgcagtgaatcgttatggaaagggtaagccaattgactctcca
ggaattactgcagagtacacatttaaacagcctggcccaccttctacgccccgtgttgct
catgccaccaaggtcttcatgctcgtcacatggaatgcgccagttaatgatggtggtagc
acagtccttggctatcatttagaacgcaaggagagaagcagtattctttggacaaaggtg
aacaggacaataatcaaggatactgaattcaaagtaactggaattgaggaaggtatgatg
tatgaattccatgtctatgctgaaaatattgctggaattggcaaagcaagcaaagccagt
gagcccatagctgcacgagatccctgtgatcctcctggtcagcctgtggtaactagcatt
accaaatcctctgtttctctttcttggaccaagcctgagtatgatggtggagccaaagtt
actggctacataattgagcgtagagatcttccagagggtcgctggataagatgcaatttt
accaatgttgtagagacttattttgatgttactggcctaacattggatgagaaatatgat
ttccgtgtcatcgcaaagaatgctgctggactattcagtgagccatctgacaacactggt
cctattacagttaaagataatgtagatccaccacgcattatgatggatgtcaagttcaag
gatgttgtggtagtaaaagctggggaaaccctgaagattaatgctgacattgcagggcgc
cctcttccagttgcatcttggtcaaaggatggacatgaaattgaacagaaggcaataatt
cagataactggaacagatactagtactatgatagtagttaaagactgcaaaaggagtgat
tctggacagtacgctttgactttaaagaatgttgcaggaagtgtcacaacaccagtaaac
tgtgttattctggataaaccaggaccttcagcaggaccactatcagtaacaggcctcaca
gcagaggagtgcacactgtcatggggaccaccacaagaaattggtggctctgaaataaca
cattatattgttcagaaacgagagaccagtcgattggcatggacacttgtacatggagag
gtcaaaactacaacattcaaggtcactaagctcctaaaaggaaatgagtacatattcaga
gtattagctgtcaacaaatttggacttggtgaagcccttcaaagtgaaatggtcaaggtc
actgaaccatacactatcccaggagctccaacaaatgttgaaattacaagtgtgaccagt
gaggaaatgaggctagcttggacaaaatctgcatctgatggaggcagcgagatccttgga
tatataattgaaaggcgggataaatctggtcttcactgggtccgtgtgaacagggacctt
gtgaaagacctaacagctgtaatatcaaaagtaagaagaggatgcgagtatgagtttagg
gtttatgctgaaaattcagcaggcttgagtccagccagtgacccatctccttcagcaagg
gcagaggatgaacttttggtaccatccccaccaactaaacctaagattctggatcatacc
aagaattctattactattgcctggaaaaagccattatctgatggtggtgcacagatcctc
ggatacagtgtagaatataagaattctgaggatacagaatggattgtggctattcagatg
acaaaaagcaatgaattcacagtttctggtcttacaactgatgtacagtatgtatttgct
gttaaagcaatcaacaaagttggtgtcagtgaacagtcgcctgtctctgagtcacagtca
gcaatggagagaaaggaggagcctgtatttgacattgacattgagatgcgaaaaacttta
attgtcaagcatggtaattcattcactttgacggctccatttaaaggaaagccagtgcct
tcagttacatggaataaagaggaggtcgatctcaaagcaagggcaagcatagaaacaaca
gaaacatgcacatctgttactattgagaaagcaacacgaaatgactctggacaatacatt
gttactttggacaatggtgttggaacagcgtctttgccagtgatggtcaaagtccttgat
acccctggaccaccaactaatgtgaaaattactgaagtcacaaaagtttctgctacagtt
acttgggaacctccagagaatgatggaggagatgctgttaaggcttatcatgttgagaaa
cgtgaagcaagcaaaaaggcttgggtatgcgtaacaagcaactgtcacagtctgacatac
agggttgaagacttgcaagaaggtgcaatctactactttagagtcactggagaaaatgag
tttggaacaggtgtaactgctgaaactaaagatggaaccaagataacagaaaaaccaagt
ccacctgctaggcttggcgttactgcagtaacaaagaatagcgtcaccattgcatggtca
aaaccagagtatgatggtggaagccgaattaccagctacctcattgatgcccttgaaaag
ggccaacagaagtgggttaaatgtgccactgttaaagccaacacccacattattaagaac
ctaagggaaaatgcagaatactttttcagagttcgtgctgagaatcatgctggacttagc
gaaccaaaagaaatgattattcctgtggttgtgaaagatcaacttgatgcgcctgagttt
gatatgaagaatttcccacataacactgtttatgtgagagcaggatcaaatcttaaattt
gagcttcctctctcgggtaaaccaatgccaaaagtcacaatgtcaagaggcaatgctcca
gttaagtgcggcaagagatttagctttgaagtaacccctgaaagtcttaatatcaacctc
aaggaaagtactgcaagtgatgctggaagatatgacattgttgcctcaaacacaagtgga
accaccaagatgtttgtaaatatactggtcctggatagaccaggtcctccagtcggtcct
gttgaagttagtgatgtgagggagacaagcttgtgtctcaaatggctcccacctgtgtat
gatggtggcagtcctgttacaaactatgttgttcttaaacgtgaaacaagtactccagcc
tggacagaagtgtcttccacaattgcaagaagcactgttaaagtcaccaaacttacaaag
ggagaagaataccagttcagggttaaagctgagaatcgctttggcatcagtgatcacatt
gattctcagtcagttacagtgaagcttccatacactatacctggaccaccatcaacacca
tggctgggttatgtgtcaagggagagcctcactgtttgctggaatgagccagtagtagat
ggaggaagcccagtggttggataccatgtccaaatgaaagaaagaagcagcattctttgg
cagacagtgaacaaaaccgcaatccctgcaactcaaattagagtgacaaatatatgtcct
ggaatgatttacgaattcaaggtagctgtagaaaatgcagctggtattggaaagttcagc
aagacatcagaagaagtgctagcaattgatgcctgtgaaccaccggcaaatgtgagaatt
tctgaggttacaaaaaattcaattagccttgtatggcagaagcctccatttgatggtgga
agcaaaatcactggctacattgttgagcgaagagatgctccaaatggcagatggacaaag
gcaaactttaccaatgtcattgatactaacttcactgtatcaggcttgactcaggatcag
gcatatgaattcaggatttttgccaagaatgcagttggctcgatcagcaatccatctcta
attgcaggaccagtaacttgtgtcgacatttctggtgctccagtaattgacctgccccca
gagtatttggatgttgtgcaatacaaagctggtacatcattcaaaatcaaagtgggaata
tttgctaaacccttgccaactattgaatggcttaaagatgaaaaggagctagtgtcaagt
gcacagctgtcaattgagaacacaactgactcatctgccatcctcattaaggacgctagt
cgtcttaatactggaacctatgagctcaaaatcaagaatgtatttggcacagcgtctgct
tctatcagaatacagattttggacaaacctggacctccagctggacacattgaattcaaa
tcagtctctgctgacaagataacaattgcatgggaaccagtggctgatgaaggaggtgcc
aaagtaactcattacattgtagaaaaacgagagacaagtagagtaatgtggtccccagtt
tctgaagcaatggaagcacgtactgtcactgtccaaaagttggccagaggaaatgaatgc
atattccgtgtcagaggtgttaacaaatttggagctggagatcctctggagtctgagcct
gtaattgccaaaaatgcatttgttactcctggacaaacttctacacctgaagcaacagat
atcaccagaacatcaatgcagattgtttgggataaaccaggtgtggatggtggtagcatg
gttacaggatactatcttgagagacgtgacaagaagagcctgcgctgggtaaaagtgtac
aaggaccccattagtgacaccaaagcaaaggcccatcatctcacagaaggaaatgaatat
cagtatcgtgtatgtgcaatcaataaagctggggaaggtccatactctgatgtttctgac
ttgtacaaagctgctgatccagttgacccaccatgtgaaccaactatgctcaaggtagtg
gactcaactaaaatatcaatcacacttggatggtcaaagccagagtatgatggaggcagt
gaaatcaccagctatgttgtagaaaaaagagttggtgaggaaggggagtggacagtgatt
agccgtaagggagaagtgagaaccacagagtatgttgcctcagaccttaaaccagatatt
gactactacttccgtgtatctgctattaattgtgctggacgtggagacccaatagaaatg
gaagagccagtacaagccaaggacattcttgaggaagcccaggtgataatatcttgggat
gagccaaatgataatgggggtggagaaatcacttgttacactgttgagaaacgtgacacc
tctcagacagactggaaaatggcttgttcaagtgtgattggaacatcatttaaggtaccc
aatctgatcaagggaattcaatatcagttcagagtctgtgcagagaatagatatggagca
agtgaacctttagtttcacaaaatgtaattgccaagcatgagttcagaccacctggccca
ccaggcatgccagtggtttacaatgttacaaatgatggcatgactattcagtgggatgca
cctatttttgatggaggttgtccaatccttgggttccatgttgaaaagaaggagaagaac
agcataatgtggcaaaaagtcaacatagtcttggtcaaagaaagggagtacaggattcct
ggtcttattgaaggcttggaatatcagttcagagtttacgcccagaatgacgctggatac
agtcgcatgagtgatgcaagcaaacctgttatggctgtttctccagttgatcctcctggt
acccctgactacgttgatgtaacaagtgaatcagttcaactgaaatgggaagcacccaag
cgtgatggtggaagcaaaattgttgcctataatgtggaaaaacgacagggcaaaggacgg
tggttaaagaccaatttttcaaatgtgactgacacagaatttacagtgactggtcttgct
tgcggtgaacgctatgaatttagagtcatagcaagaaatgctatcggcacagtgagccca
ccctctcagtcttctggatatgtcttaatcagagattacactgccaccaaactgatcaag
acaaatgagtatcagttccgtgtttctgcagtcaataggtttggtgttagcagaccactg
gattcagttcccgtgatcgcacagatgcaatacactgttccagattctcctggaactcca
gatgcaacagatgttgacggagagagtatcacaatcagctgggctccaccaacacatgat
ggtggaaacccaattaaatattacattgtggaaagacgtgaaaagaaaactggtcgctgg
ctgaaagtcataacaaggaaacccattgttgaggctgcacacagagtgactcatctcact
gagtatgtggaatatgaattccgtgtgtatgctgtaaatgatgctggaattggagcacca
agcaacatttcaatgccaattaaatgtgcagagccaactgaagaacctgatgccccatct
attgtcaatgtgactgacactaccaatacatctgtcagcttggaatggaccagacctgcc
tataatggtggtatggaaatccatggctacattattgagatgtgcaagggatctgaagcg
gaatggcacagagtcaatgaggatctttgtgctgtcacaaaatacaatgtcactggtttg
gaaactggtgcagagtacaagttccgtatttgtgcagtcaattctgttggaaagggcgaa
gccaaagaaatacctgagtctgcactggcagtagacaggctcttggcaccagaaattgac
atagatgcatccttcaaacagacacatattgtgaaaagtggtggaagtgtatgtatccgt
attggctttaagggaaagccaacacctacagcttcctggacaaaagtagatggagaactt
ggtgttatgacagacatcaccaccactgagacattcacagccttgacactggaaaactgc
actagaaatgatactggaaaatatactctcactcttgagaacagtagtggcaatacatct
atcactgttgcagtcaaagtgttggacacacctggtgtaccaggggctctctccatcaag
gaagtcacaagaggagctctcacaattgtttgggaacctcctacaaatgacggtggtgca
cgtgttcatcattacattgttgagaagcgtgaggcaagccgtcgtacatggacggaggca
gcacccaagaccactcaaacaagcttgagagtttctgatctcttggaaggtgtaccttat
ttcttcagagttatggctgataatcagtatggtcttggtgaagcgtatgaaatgtctgat
ccagttattgccacagctgaacctgctccaccaaagagagttgatatcattgatacaact
gacacatcagcaaccctggcctggctcaagccagagcatgatggaggaagccgtatcaca
ggctattgtgtagaatccaagggaaaagatgcagataaatgggttgtttgtggtacaaca
aaaaatctaagccttgtaattgaaggacttacagagaacagtgagtatgaattccgtgtc
aaggcaaagaatgattctggcttcagtgtgccaagagaagctttctcctcagtcatcatt
aaagagccacgaattgaacctactgccgatctcagtggtattaccaaccaactcataact
agcaggattggcgaatcttttgagattgatgttccaattagtggaagaccagctccaaag
gtatcctggaaacttgaggaaatgagactgaaagaaactgacagggtttcaatcaagact
aacaaaaacaggaccactctcacagttaaagactgcatgagaggtgatggaggcagatat
ttcctcacccttgagaatgtcactgggccaaagactttcactgtcactgtcaatgttatt
ggcagaccaagccctccagagggccctattgagatttcctcaattacatcagagtcatgc
atactgtcttggaatccacctgaagatgacggtggcacagacatcacaaactacattgtt
gagaagcgtgaatctggctccactgcttggcagcttattaactcaagtgtaaaacatact
tctttccatgtttcacatctaactaaatacatgcagtatactttccgtatctgtgctgaa
aaccgttttggtgtgagcaaaccaacagaatctgagacgattgttgcagagcatccattt
gttcctccaggccctccaacaaggccagaagtgttcgctgtaactgccaacagcatgagc
attcgttgggaggaaccgtaccatgatggtggcagcaaagtctctggatactggattgaa
aagaaggagcgtaacacaattctctgggtgagagaaaacaagattccctgctttgaatgc
tactataaggtggaaggccttgttgagggtcttgaataccagttcagagtgtatgcaatg
aatagcgctggcctcagcaaagcaagtgaagcatcaaaaagagctgtggcacaaaatcca
gttgatcctccaggaaaaccagaagtaaaaaatgtatcaagatcaacagtctcaatcaaa
tggtctgtgcccctaaacgatggtggaagcccgattacaggctacattgttgagcgcaag
ccttatactgtcactggagaaggtcgctggcttaagtgtaactacactaatgttaccgac
acaaatttcactatcactgcactgggagaaggagaggaatatgaattccgtgtaattgcc
aaaaatgcaaatggagtgttgagcctgccatcagtttcaacaggaccagtgacctgcaaa
gcagaatacattcctcctaaagcagagctggacagcaaactccttgtggacacagttgta
attagagctggatctgatctggtgctggatgctgctgttggtggtaaacctgagcctaaa
ttcagctggtccaagggcacaaaagagctagagctttgtgaaaaatatgctctccaatat
tcaagtacccgtgctctggcaatcatcaagttctgtgacagagatgacactgggaagtat
gttttgacagttaaaaatgcaagtggaacaaaaaccgctgaggtcaatgttaaagtgctt
gatacacctggtccctgtcaggagattacagtcagcaatatatctgaggaaaaatgcaca
gtgtcttggaaagagccactggaggatggtggtgaccccatcacacattacattgttgaa
cgaagggataccaatagacttaactgggttatcatggaggctgaatgcaaagccctaaca
tgtgaaattaaaagacttttcaagaataacgaatatatcttccgtgtgagaggtgtgaac
aagtatggatctggtgtggcagtacagtctacccccatctttgccagaaactcattcact
gtcccatcacctcctggagcaccagaaatccttgcagttggaaaagactatgcaacgata
gagtggctgaagcctgagagcgatggtggcagtgaagtcacaaactacttgattgagttc
cgtgaaagaaagagtgttagatggatcaaggttaacagagattctgttctcaaggacaca
tcctttaaagtcactggtctccatgaaggcaacatttaccagttccgtgttacaaccatg
aatgcagctggtgatggtgaacctagtgaagtgtcaatgtatgcagtatgtagagtacca
acaggcacttcagatccaccttcaattccacgggttacagacacacacaaagatagtatt
agccttgcctggacacgaccagttgaagatggaggtgctgatgtaattggttacgttctt
gaaatgcaagaagctggtgcagaggaatggacaaaagtgcatgaaaagaatcttagggtg
acagaacacacagttacaggtctttctgctggcaaaaaatactgtttcagagttgcagct
gtcaatgtaaatggaatgggtgacttcagtgaaccttgtgcagagactgagcctgtggaa
agaattgaaattcctgaccttgagctgcctgatgaactgggaaagacaatttgtctgaga
gcaggaagttctctgcggctccatgttactgttactggtagaccgatcccaacggtaacc
tggagcaaacctggtgtggacctccaaaatcgtggctttattgaagtgaccaatactgct
acaactctcattattgacaaggtgcaccgctatgatgctggaagatatacaattgaagct
tcaaattcagctgggaagaaggatgcaagcattcttgtgaaaatctatgatacacctggt
ccaactggtccaattaagttgaaagagcttacaaaagattctgctcacattacttgggat
gctcctgaagttgatggtggagcacctgtcaataattatatcattgaaagacgagaggca
tcaatgagagcatacaaaactgtcacatccaattgcagcaagacatcatacaaaataact
ggtctgacagaaggaatgctgtattatttcagagtcttaccagagaatatctatggtgtt
ggtgaaccttgtgagacaggtgatgttgtgttggtctgtgaagttccactgccaccagcc
aagcttgaagttgtagatgtaaccaaatccagtgtatcacttgcctgggagaaaccttta
catgatggaggcagcagaattactggctacattgttgaggcttgtaaagctggtactgac
aagtggatgaaggtggcaactttgaaaattacagactttgagttcactatcatgtcactt
aatgagaatgagcagtatctcttcagggttcgtgctgtcaacagcagaggagctggtgag
ccaaaagaaattgtaacagctgtgacagttcaagaacaaagagtcttgccaaaggttgat
ctatcagctattccacagaagacgataagtgttttggcaggcaaaccccttgagcttgac
ttaccaattataggacgaccaccaccagtttgttcttggttcttcaatgacaatagggta
aaaattgtggagcgtgtgaagataaagtcaactggaaaattctctaaattaaccattctt
gacactaccattgatgacagtggagtgtataaacttgagttgaaaaacatgacaggagta
actactgaaaacatcaaagtcatcattctttccaaacctgatgagcctcaaggacccatc
cgatttgatgaaattgatgcaacatcagtcacaataagctgggatccacctacgagagat
ggtggtgcaccaattagcaactatgtggttgaccaacgtgatgctcatcgcccaggatgg
gttcctgtgtcagaatctgtgtccagaccaacattcaaatttgtcagattgacagagggc
gatgaatatgtgttccgtgttgcagcaaccaatcgctatggcactggggattacttacag
tcagaaatcgtaatgtgcaagagctccaaatccattcctgggccgcctggaagacccatt
gtatttgatgtatcacgtgatggcatgaccgttgcatgggagccaccagatgaggatgga
ggcttagaggtgtctggctatattattgaacgcaaggaggtcagatcagataggtggatc
cgtgctaataaaaatccagtgacaatgacaagatacagatccactggattaattgaaggc
ctggaatatgaacacagagtgacagccatcaatgctcgtggtgctggcaaacctagcctt
ctttctaaaccggcagtagcaactgatcctgttgatccacctgggtcacctcaaaaccca
cgggtcacagataccacaaagtcttctgtgtctttggcctggagtcctccagatgaggag
ggtggtgctaaggttacaggctatctaattgagatgcaaaaggttggttcagtaacctgg
atgaagtgtaacgctacaccttcactgatctgtgaatataccttgacacaaatgccgcaa
ggagaagaattcaaattccgtgttatggcttgcaatgctggtggaccaggtgaaccagct
gaagtaccaggagttgtgactataacagagatgcttgatcctccaagttatgatcttgag
gcaaaatacaaagatgtccttgtagtcagatccggaggagtaatcaaactttcagtgccc
atcaaaggcaaacctactcctacctgcaaatggaccaaggatggtttagaggtgaccaac
cgtgctatgattgcctccaatgaagacatatcagagcttgtaatcaaacaagctgaaaag
tctgattctggagtttacaatctccatctggagaacaagtgtggcaaaaaaatgcttgct
ataaaggtcaaggttattggccgcccatctgcacctgaaggccctcttagatttgatgac
atacaagcacattctgtaaaagttagctggaaaccaccaacagaagatggtggttctgaa
attgttggctacattgtggagagacgggaagtaacaaaagcagcttggtacactgttgac
tcgcgagtggttgacacatcccttgtggttaagggactacaagaaaatgttgaataccac
tttaaggtgacagcagagaaccagtttggaataagcagctcactgaaatcagagacaact
gttgtaccaaagactcccatttgtgtcccagaggcttcaggcactccaccagaaattatg
gatgttactaagaattctgctgctttggcttggactaaacccaaagatgatggtggatct
cgcattactggttacttcattgagtacaaagaagtgtcgtctgataagtggattcgtcat
gaggcaaagattacctcaacaatgtatactcttagtcagctcactactgattctgagtat
cagttccgtgtaattgctgtgaatgacattggagagagtgaaccaggacctgcatcagat
tcagtaatatgcaaagatccatttgataaaccaagccagccaggagaaattgacactatg
actgttaccaaagactacattacaattaattgggaggctccagcatgtgatggtggaaaa
ccagtccttggctactggattgaataccgaaagtctggagagagtgcttggaagaaatgc
aataaggagcgcacaaaggacaaacagtacactcagggtggtctacaagaggcaacagaa
tatgaattcagagtatttgctgaaaatgaaaccggaattagcagaccacgcagaacagca
actggcatcaaaactaaactgggtgttggaactaaaccagctctcaggaaagagatggat
gaggtcactgccaaactaggacaaactgcaactctcaaatgtcagattattggaagacct
gttccagaaattaaatggtacaagggtggaaaggaaatcaaagaaggtcgcaaatatgca
gcaacctcggatggccgtaatcatacactgacgatttcaaccgatcaacaggaagatgag
ggtctgtacacatgcaaggctgtgaatgaggccggcgagtgtgagaccagtggaactctg
gtccttgaagcagcaccacagttcccagtgccactgaaagacaaattctttgcaacatgt
ggtagcacagtgcgcatacatgctgtttacattggtcgacctcagcctaagataatgtgg
ctttatggagccaaggctttggaaccctctgagaatgtgataattgaaaatacagagcat
tacacacatttgattctcaaaaacgtacagcgcagagtaaacggaggaaaatacagaatc
aggattaacaaccattttggggctgcagatactgtaactcacgttgaaatcttagataaa
cctgctatgccagaaggtcctcttgtacttgatgcactgttgaagaattctgtgataatt
agctggaaagcacccaaagatgatggaggatctatgatctcaaattatattgtggaaaag
cgtgaagacaaggaaggaacagagtgggaacttgtatcttcatctatcacaggcacttca
tgcagaattcctaaccttgttgaaaacgagggatacttcttctgtgtttcagcacaaaat
cgttatggcaatagtgaatcactggaaactcctgctgctatcctcatcaagagtcagcta
cagaggccaggagctccattaaaaccagttgtttctggacttaccaaaaactcatgtgtt
gtgtcttggaagccacctctcagtgatggaggctctaaaattaagaactattgtcttgaa
aagcgagataagaagaagggtgaatgggttgcagttacaacagatgaaatccaccagact
gtttattctgtcaagggcctgacagaaggtgttgagtatgaattccgggtgaaatgtgaa
aaccttggtggtgaaagtgagtacagtgaagtatctgaccctgccattccaaagactgat
gttgaagtgcgtgctcctgccttcaaggaagatctcagaaatatgagtgtaaaattcaag
agcaatgcaacatttgtctgcaagataacaggacagcccaagcctgtaataaaatggttc
aagcgtggtaaggaaattcaagctgatgacaccaaagtcaagatccaagaattcaaggga
ggctaccagcagcttgttattgctgattgtgatgcagaagactcaactgtatatcagatc
agagcaacaaaccagggtggatccatttctgctactgtttctctagatgtagaaatccct
gctaagattcatctacctaagaatctgcaaggaaaggaggctatccctgcacttcgtggt
gaagttgtgaacatcaaaattccattcagtggaaaaccagatccagttatcacttggcag
aagggacaagaccttcttgataatgatggacactatcaagtcattgtcacaagatctttc
acatctcttgtattccagaatggagtagaaaggaatgatgctggtttctatattgtgtgt
gccaaaaacagatttggaattgaccagcaaacagttgagcttgatgttgcagatgtgcct
gatccaccacgtggcatcaaagccagtgatgtttctagagattctgtaacactccactgg
gtaacatctgccaatgatggtggaagtaaggtcacaaactatatcatagaaaaatgtgcc
accacagcagaaagatggattcgtgttggccagtctcgtgacacccactatactgttgtc
aatctgtttggaaagacaagttaccaattccgtgtcatagctgaaaataaatttggtcag
agtgcaccgtctgagccaagtggacctgttgtaacgaaggaagacaaatcaagagttctt
aactatgatgaagaagttgatgacaccaggccagtttccaaaagcaaagctcctcattta
gatgctaagaatgttcacaacaagtacatgattgctgaagagcttggccatggacagttt
ggtattgttcaccggtgcattgaaaccagctctgagaaaacttacatggctaaatttgtc
aaagtaagaggtgcagatcaggcactagtgaagaaagaaattgcaacactgaatgtggca
cgccacaagaacttcctgttactgcatgagtcatttgactgccctgaagaactagtcatg
gtttatgagttcatctctggtgtggacatatttgagcgccttggtacagccaattttgag
ctcaatgagcgtgaaattgttaactatatcagacaagtatgtgaagctcttgaattcctt
cacagcaagagttatggccactttgatatcaggcctgaaaatatagtgtacaccacaaga
aagggaactaatgtcaagatcattgagattggacagtctagacaccttacacctggggac
caaattaagattcagtacacaacagctgagtttgcggcaccagaaattcatcaaaatgag
atggttagcactgtgacagatatgtggtctgtcggtgttcttgtgtatgttcttctcagt
ggatttaatccatttgtcgctgaaactaatcagcaaatgattgagagcatttgcaatgct
gagtacagttttaatgatgaagcctttaagcatgtaagtgttgaggcattagactttgcg
gaccgcctactaaccaaagagcgcaaacatcgtatgaccgctgctgaggctttgaatcat
ccttggctgacaatgaactcagagcagctaagcactaggtccatcaagattactcgccat
aagagatattaccaagccatggttaggaaagaatggaacactgttgtctcatctgctcgt
gttgccagtggtggtgctatcaggagtcagcggggagtaacagtctctaaagtgaagatt
gcaccatttgaacatggaccagttgcaggacaaattaaacacagtgctgctgatgaaggt
gatgatatcaagctcatttgcaacattgataactacgatagcaccaccgaagtaacatgg
tactgtggagtaagacaactagaagaaggcactaaatacgaaattacttatgaagatggg
cttgctaccataactatcaagggaatcacaagaactgatgatggaacatacagatgtaaa
gttgtcaatgagtatggtgaggacagtgcctattccgagctctttgtcaaaggggtaaga
tcctatcgtgagttctacactacacgtgttgtaaagaaagtaaaacgtagagttgacaca
gcaagactactccaaagacctcctgaattcactttgccactgtgtaaccgcacagcttac
attggagaggatgtgcgctttggtgtcacaatcacagtgcatcctgaacctcgtgtaatg
tggttgaaaactggtcaaaagattatgccgggagatgatgacaagaaatacacttttgtt
agtgataagggcctgtatcagttagttattcacaaacttgacccagatgatgatgcggaa
tacactgttgtggcacggaacagatttggtgatgacagttgcaaggctcgtctcacagtg
atcccttgtcctgctcctgctgataacactttgagacctatgttcaaacgtgttcttgct
aacttggaatgcagagaaggccagagtgtacgttttgaaatgagagtgtcaggacatcct
tcattgaaatgggagaaagatggcatgcctttggcatttggtccacaaattgaagttgtg
catgaaggcttagattactatgtcttacatgtaagagatactcttccagaggattcgggc
acataccgagtcattgcaactaactcagctgggtctgcaagttgccaatccacactcaag
gttgaacgtgtgacacacatcaagaaggaggagagtgaggaagaaaagaagaagaaacat
gatcttgatcagcaagagatggacaagaaagtaagactaactcaaatactagcaggtgca
gatgttaacccacttactccagtcgcacagcaagcactaagagaagctgcaactatgttc
aagccagcaatcactaccaagaaagtcaagagtgaagctgaggaagccaaagaaaaagag
gagaaaaagaagagagcagaagaaaagaggctgagaatgccatatgttattcctccacct
cgtgttgttgctcctactgctcttgaggaggatatggaaatcaaacactttgttcctttc
tctgatatgaagtggtacaagaaactccgtgatcaatatgagttcccggagccaatggaa
aagttcccccagaaaagacttaagcgcatccgactgtcaagatgggatcagttctatgaa
gtacccctgccaagaattaatgaccaatacaagccaaaatggcatattcctgtttcacag
gatgaccttgagactgtaaggccagcaagacaccgcacaccttctccagagatggaggct
tactacagaatcaggagacactctcttggtgatctttctgatgaggaactgcttctgcct
gttagagaatacttgtcaatgaagagaacagaagaagaaagacttaaactcgaggatgaa
cttgagttaggctattctgcttctccaccaagtcttagccctgtacgctttgaactctct
gcactgcgtcacccatcacctaagagagctgcatatgatgaggaggaaggggaggaagtt
ccaacatatgactcttaccgtattccatctaaatatgaggctggtccaagctatattgac
ttacgtcagcgtcacgatagggcaacatacagacctccaaggcaaaaacaaaggttatat
gaggaaaaagaggatcaggaactgcttaggtctgtcacgacagccacaaaattaacttcc
tacaagagccaactgcagcacattgagttcgaggagaaaacaaaagtcaaaagaaaggag
aaaacaagagtttctgtgtcagcagtaactgaggcagcagtcctaactgaaatacctaca
acatcattctctcctggctatgctacagtaactcgtcctaagaaaccttctgcagctctg
gcagaaaaagaagtggttagaacaacttcacctgaaaagacacgcccacgttcccccagc
cttgattctactgagaaaccagacactacaccagacttatcaacaaaaattgattatatg
tcaaggtatgagtcaagaaagaaagccttgaaaactgagaggaagtttgaaattgtgacc
cagcggccttttaccctcgaccatgcacccagagtgacagtaagaatgcgctctcaccgt
gtgccaattggtcaaaacactaagttcacaatgaatgtccaatcgaagccagaagcacag
attaaatggtaccacaatggactgcagattgaagaaagcagaaaataccgtatatttaac
atgagtggcgttttgtctcttcaaatcattgattgtcaggaagaggacagtggcacctac
cgtgttgtctgcacaaatgcaaagggagaggcctctgactatgccactctcgatgttgct
ggtggaggattttctgcatatgcctcgcaacgtaaggatgaggagccaccaactcccttt
gtccctgagatgacaaaaacagatgtttatcatgtttcatctacaaaagcagcatctgta
tcagaaacacaaatagaagtatctgaaattaaaacagacaagatagaagagacaattgag
actgttgttcaggaggagaaggtaacatctgaaatcaaacttgaaactatggaagtgaca
gcagttgaggaagttgtggttgagaaaatttctgagactaaacttgaagctacagaagtg
acaacagtagtggaagaagtggttgaggaaaagaagccaactctcccagctacaattttg
actaaaccacagtcactcacagtatctgagggagaatctgttaaattcacatgtgatgtt
gatggtgagcctgcacccactgtaacatggatgcgagagacgcaagtaattgtgtcatct
catcgtcaccatattacctcaactgaatataaatcgacctttgagattacccaagtagaa
acgtcagatggaggtaattacactgtagtggtagagaactctgaaggtaaacaggaggca
cagttcagtctaactgttcgtaaaccaacacctgtacagaaagttgttgcttctcctcca
agagtgaaatctccagagtccccccgtataaagtcaccatttggaattaggtctccacag
agaattaaatcacctgaaccaattaaatctccaccaagagttaagtccccacccatggta
aaatcacctactccaaaagaaaaaacatccaagccaaccttctcagcagaactaaaagac
atctcagcctctgcagatactattattaagcttacagtgaaagtgtccggtgagcctaag
ccatcaatctcttggatgaaggatggaaataacctctctcaaggtggaaaatatgaaatc
tttgaaaaacatggttcagcacatcttgaaatctatgaagctgatgtctctgatagtgga
gtatacacatgtacagccaaaagcagtgctggatctgttactacaaactgcactgttacc
gttcaagtgcggacaacgacagttggcatggaacggaaagcagagatgacagagcaaata
gtgaaaaaggagattgcttttgaggaagtgcagtcctttacagaaattaaagcatcaaaa
acccaaatgacgatgaatcaaggtcagactgttacgctacgagcaaacatccctgaagcc
tctgatgtgaaatggatcctgaatggagcccagctatcaaattcagagaactacagatac
ggtgtgtcaggaaatgatcacaccctgacaattaaaagcatcagccaccatgaccaggga
attctcacatgtgaggccaaaactgaacatggtgtagtcaagtgccagtttgacatgacc
gtcagtgcaatgcgctcaagtgcaccaagtttccttgtgcaaccacactcaaagaatgta
aacgagggacaaaatgtcatatttacatgcgaaaccactggtgaaccttctcctgaaatt
gagtggctaaaggataattcagtaatatctattacatcgaacatgaaattgagccggtct
aagaatgtgtacacacttgagattcacaacgctaccactgaagacagcggaaaatacaca
gtaaaagcaaagaacaaatttggacagtgctctgcaacagcatcactgaatgtcctcacc
ctggttgaggaacctgccaaaatgataattgtggagaaagcctctgatgctacgagcatg
cagggcagttattctgccaagcatgtggtttcaaaaatgcaagagacatccttcagcagt
tccagcatggctgaggttaaatttgaaagcatgtcagcgtctagcatgacctccatgact
tctgaaagaatgatagctatgagctccagcagtatgatggcactgtccagtcactcgcat
gttgaggggtcatccatcaaagccatttctcatggccgcaaaggtataccaccaaagatt
gaggctgctcctcaagatatcagtattgagtcagggaaggtcctgactgtagcctgtgct
ttcattggagacccaaccccttgcatagaatggtcacattcagggaagacactgtccagc
aaggcgcaagagagtggacgattgcagattgagacttctcaagatgtcaccactcttgtt
ataagtggagtgaaagagactgatgctggtgcatacaccttaaaactttttaacgagttt
ggatttgataccactactgtcaatgtcaggattcgattgatgtaa

DBGET integrated database retrieval system