KEGG   Sinocyclocheilus anshuiensis: 107702309Help
Entry
107702309         CDS       T04917                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 2 chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04217  Necroptosis
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04310  Wnt signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107702309
   04310 Wnt signaling pathway
    107702309
   04020 Calcium signaling pathway
    107702309
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107702309
   04217 Necroptosis
    107702309
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107702309
   04916 Melanogenesis
    107702309
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107702309
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107702309
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107702309
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107702309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 Mltc_N SnoaL_4
Motif
Other DBs
NCBI-GeneID: 107702309
NCBI-ProteinID: XP_016360068
Position
Unknown
AA seq 493 aa AA seqDB search
MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
ESVHHCHVNGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPDAKDLINKMLTINPSKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTLLVTRNFSAAKSLLNKKTDGVKEPQTTVIHNPVDRNKESTESANTTIEDEDIKA
RKQEIIKVTEQLIESINNGDFEAYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSK
GNKPVHTILLNPHVHLIGEDAACIAYIRLTQYMDGSGMPRTMQSEETRVWHRRDGKWLNI
HFHRSGAPSVPII
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaccatctgcaccagatttacggacgaatatcagctttttgaagagctcgga
aagggtgcattctctgttgtgaggcgatgtgtgaagatatcatccggccaagagtatgcg
gccaaaatcatcaacacaaagaagctgtcagccagggatcaccagaagctggagagagag
gcaaggatttgccgtctcttgaaacacccgaatattgttcgactccacgacagtatatcg
gaggagggtttccattacctagtttttgatctggttactggaggtgagctgtttgaagac
attgtagcaagagagtactacagtgaggctgatgccagtcactgcattcagcagattttg
gagagcgttcatcactgccatgttaatgggatcgtccacagggatctgaagcctgagaat
ttgctgttggccagtaagatgaagggggcggcagttaagcttgctgactttggtttggcc
atagaggtccagggtgatcagcaggcatggtttggttttgctggtactccagggtacctg
tccccagaggtcttgaggaaagatccttatggcaaacctgtggacatgtgggcctgcggt
gtgattctctacattctgctggttggatatccaccattttgggatgaagaccagcatcgc
ctctatcagcagattaaggctggtgcatatgactttccttctcctgagtgggacacagtg
acccctgatgctaaagatctgattaataagatgttgactatcaatccttctaaacgcatc
acagctgctgaagccctcaaacacccttggatctgccaacgctccactgtagcctctatg
atgcacagacaggaaactgtggagtgcttgaagaaattcaatgccagaaggaaactcaag
ggtgcaattttgaccactctcctggtcacaagaaacttctcagcagccaagagcttgttg
aacaagaagacagatggtgtgaaggagccacaaactaccgtgatccacaacccagtggac
agaaacaaggagtctacagagagtgccaacacaaccatcgaggacgaggacattaaagct
cgaaagcaggagatcataaaggtgaccgaacagctgattgaatccatcaacaacggagac
tttgaggcttacgcaaagatttgcgatcctggccttacttcctttgagccagaagctttg
ggaaatctggtggaggggcatgacttccaccggttctactttgagaacgcactgtccaaa
ggtaataaaccagtacacactatcttgctgaacccccatgtgcacctgatcggagaggat
gcggcatgtatcgcgtacatccgtctgacccagtacatggatggcagtgggatgccacgc
accatgcagtcagaggagacccgtgtctggcaccgtcgagatggcaagtggctaaacata
cacttccatcgctctggagcccccagcgtgcccatcatttaa

DBGET integrated database retrieval system