KEGG   Sinocyclocheilus anshuiensis: 107702807
Entry
107702807         CDS       T04917                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107702807
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107702807
Peptidases and inhibitors [BR:sanh01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107702807
SSDB
Motif
Pfam: TSP1_ADAMTS Reprolysin ADAM_CR_2 TSP_1 Reprolysin_4 Reprolysin_3 Reprolysin_5 Reprolysin_2 ADAM_spacer1 TSP1_CCN TSP1_spondin Peptidase_M10
Other DBs
NCBI-GeneID: 107702807
NCBI-ProteinID: XP_016360714
Position
Unknown
AA seq 1555 aa
MFKDFLESLKPQDLFYYFDTISVKSVPHFELVWVNCSGNESFRGLWRCSFQSDGESFELG
QHRNEQPMSCPTSLETVINSTVSVVKKREDMCCEQLKLLRPAHTRTLLPICHGKLQGLIQ
SGEKRLNIRPVLQKHIDHLKELTMDLPSGVPHLLLTHTLPVRTHLKQPKSQFRLRRTPLG
SEVTHLELAVVVGPDVYDAHRQDTERYILTNLNIICASELLRDVTLGANIRVHLVRMVIL
TEPKPDIQISENITSSLKSVCEWGQKVNADADTDPLHADLLLYINRFDLVLPNGNKLVRG
VTQLGGVCSSQWNCVITEDTGFDLGITIAHEIGHSFGINHDGIDNTCSSSGFMMASDGGY
NSVDLTWSQCSRAQLHNFFSAGKAECVKDVPVLGASVQDWRPGLFYGVDDQCRIAFGSSA
TACSFTNGDMASKTFTAMLATCHVLSCHINPRDRSSCTRLLVPLLDGTECGPSQPCESTQ
LEFMSQQCSATDQQPLSVSPDSSSVYTWIPAVGYSSGDAQCKLLCRSREQDFMVSRGSQF
IDGTRCEAGHTPCESTQLEFMSQQCSATDQQPLSVSPDSSSVYTWIPAVGHSSGDAQCKL
LCRSREQDFMVSRGSQFIDGTRCEAGHTVPRGFISACLGRKCQSCESTQLEFMSQQCSAT
DQQPLSVSPDSSSVYTWIPAVGHSSGDAQCKLMCRSREQDFMVSRGSQFIDGTRCEAGHT
VPRGFISACLGRKCQLFGCDGVMHSGKVEDVCGVCGGNGSTCQFISNTYSGGEAGEYVTF
LSLPLNASQVHVINTKPVFTHLAVLSNDKYVVSGDGSPGLSITYPSPLEKSPIIYNLFLT
PDHLPQTEELTISGPITDKIHIQVFRKYGQEYGDLTTPNISYQYYSSEAVSVERASEGRW
STVISACSVTCGTGIQKISQLCVDGLTLKSLEDELCSSPPRTPYQLQPCFQPDCPPSWEV
GEFGPCSAAEQVRSVTCVQKQGKVKVELPDSDCTLDSKPQTTVATELPTQLIRTDTHIMP
RSRMVPVYVWSPVIGQCSKTCGNGSQQVWFSCVDHQSRLEVPEFLCDRTNKPEMYAQPCS
LSICPATWRYIQGPCSVSCGGGVAKRVLYCSQMVQGGDGNTDLVVGESACQSVARPSEVV
ECNTEACPTRWQVGEQGDCSVSCGMGVAVRSVRCVQYEGGIERVMEEGRCDPGNKPPVTA
PCFTQVCSFHWDVHEWSECSVSCGDGIQSRTVSCMGPSSPLPVSPFLCLHLPKPITIQAC
YSPDCSSAQTSTPEPNSTHMQSEARRGEGTQRTTPAPAVRMMKMRKSFSAIVPTADVMRS
TMSTTTEPPQTSFCGQLLLQDSGTIDLRNVTQARCIFAIGRPLDEVIQIKIISSTLNCRQ
KENIALYDRLILMRLCERMTSKTLKSQSNVLLVRQSRLTPGNGVLLFYQSIKNKKSHHGE
CDVQLFSPSGLIENPIKSAATSNTQSCRVFIDAPPAFRIQIRALSVLNNTDTNSTYILIR
DVDALKTTIFRGTRLFLWSSSGSRAEVEFHGEYQQIKGMFRVEYSYMNPSEEQPV
NT seq 4668 nt   +upstreamnt  +downstreamnt
atgtttaaggattttttagagtctctgaaacctcaagatttattttattattttgatact
atttccgttaaatcagtgcctcactttgagctggtgtgggtgaattgctcagggaatgaa
tctttcagagggctatggaggtgctcgtttcagagtgatggagagagctttgagctgggc
caacacagaaatgaacaacccatgtcctgtcccacgagtctggagacggtgatcaactca
acggtgagcgtggtgaagaaaagggaggatatgtgctgcgagcagctgaagttactgaga
ccagcgcatacgagaactcttctccccatctgccatggcaaattacaaggtctgattcag
tcaggggagaagaggctgaatattaggccggtgcttcaaaaacacatagaccatctgaag
gagcttactatggatttaccttctggtgtacctcacctgctattaacccacacattacca
gtgaggacacatcttaaacagcctaagagtcagttcaggttacggaggacacctctgggg
tcagaggtcacacatctggagctagcagtggtggtgggtccagatgtctatgatgctcat
aggcaagacactgagagatacatcctaaccaacctcaacatcatatgtgcctctgagctt
cttagagatgttactctcggtgccaatataagagttcatcttgtccgtatggtcattctc
acagagccaaagccagacatccagatctccgaaaacatcacttcttctctaaaaagtgtg
tgcgagtggggtcagaaggtcaacgctgatgctgacactgaccctttacatgcagatctg
ctgttatacattaacaggtttgatctggtgttacctaatgggaataagcttgtgagaggt
gtgacccagctgggcggagtctgttcctctcaatggaactgtgtgattacagaggataca
ggctttgatcttggcatcaccatcgctcatgagattggccacagttttggcataaatcat
gatggaatagacaacacatgcagctccagtgggtttatgatggcatctgatggaggttat
aacagtgttgatctcacatggtcccagtgcagcagagctcagctccacaacttcttcagt
gctgggaaggcggagtgtgtgaaggatgtgccggtgctgggcgcttcagtgcaggactgg
aggcctggtctcttctatggagtggatgatcagtgccgtatagcgtttggcagctcggct
actgcttgctctttcactaatggtgatatggcgagtaagacatttactgccatgctagca
acctgtcatgttttgtcctgccatatcaaccctcgggaccgtagctcatgcactcgtctc
cttgttccactcttggacgggacggagtgtgggcccagtcagccctgtgagtcgactcag
ctggagttcatgtctcagcagtgctcagccacagaccagcagcctctgtcggtgtctcca
gactccagctcagtctacacctggatccctgctgtcggctacagctcaggtgatgctcag
tgtaaactgttgtgtcgctcacgtgagcaggacttcatggtgagtcgtgggtctcagttc
atcgatgggacgcggtgtgaagctggtcatactccctgtgagtcgactcagctggagttc
atgtctcagcagtgctcagccacagaccagcagcctctgtcggtgtctccagactccagc
tcagtctacacctggatccctgctgtcggccacagctcaggtgatgctcagtgtaaactg
ttgtgtcgctcacgtgagcaggacttcatggtgagtcgtgggtctcagttcatcgatggg
acgcggtgtgaagctggtcatactgtaccacgtggtttcatttctgcctgtctgggtaga
aagtgccagtcctgtgagtcgactcagctggagttcatgtctcagcagtgctcagccaca
gaccagcagcctctgtcggtgtctccagactccagctcagtctacacctggatccctgct
gtcggccacagctcaggtgatgctcagtgtaaactgatgtgtcgctcacgtgagcaggac
ttcatggtgagtcgtgggtctcagttcatcgatgggacgcggtgtgaagctggtcatact
gtaccacgtggtttcatttctgcctgtctgggtagaaagtgccagctgtttggctgtgat
ggagtaatgcattctgggaaggtggaggatgtgtgtggggtgtgtgggggtaatggctcc
acctgtcagttcatctcaaacacctattcaggcggagaagctggagagtatgtcacattc
ctcagtcttcccctgaacgcctctcaggtccatgtgattaacacgaagccggtttttaca
caccttgcggtgttatcaaatgataaatatgtggtgtctggagatggaagcccaggcctg
agcatcacatacccctcacctctggagaagagccccataatctataacctgttcctcaca
cctgaccacctgcctcaaactgaagagctcacgatctctggaccaatcacagacaaaatc
cacatacaggtgtttcggaaatacgggcaagagtatggagaccttaccaccccaaacatc
tcataccagtactactcatctgaagctgtttcagttgagagagcttctgaaggcagatgg
tccactgtcatatctgcatgctcagtcacctgcggcacaggcatccagaaaatcagtcag
ctctgtgtggatggtctcacgctcaagagtctggaagatgagctctgtagttcaccccct
cgaacaccatatcagctgcagccctgcttccagcccgactgcccacccagctgggaggtc
ggtgagtttggaccctgcagcgcggcagagcaagtgcgctctgtcacatgtgttcagaag
cagggtaaggtgaaagtagagctgcctgactcagactgtacgcttgactcgaaaccccaa
actactgttgctacagagctacctacccagctgatccgtacagacacccacataatgccc
cgctccagaatggttccagtttatgtttggagtcctgtgattggccagtgctcaaagacc
tgtgggaatggatctcagcaggtttggttctcctgtgtggatcaccaatcacgtcttgaa
gtcccagagttcctttgtgatcgtaccaataaaccagagatgtacgcccagccctgcagc
ctatcaatatgtcctgctacgtggcgctacatacagggcccatgcagtgtgtcttgtgga
ggtggtgtagcaaagagagtcctgtactgttcccagatggtgcagggaggagacggaaac
acggatctggtggtgggagaatctgcttgtcagtctgtggctagaccttcagaggtggtg
gagtgtaatactgaagcctgtcctaccaggtggcaggtgggagagcagggtgactgttcg
gtgtcatgcgggatgggtgtagctgtgaggagtgtgcgatgtgttcagtatgaaggagga
atagagagggtcatggaggagggccggtgtgacccaggaaacaagcctcccgtcactgca
ccatgcttcacacaagtctgttccttccactgggacgtgcatgaatggagtgagtgctca
gtgtcatgtggtgatgggatccagtctcggaccgtgtcctgcatgggcccatccagccct
cttcctgtcagtccctttctttgcctccacttgccaaaacccatcaccatccaggcctgc
tatagccctgactgttcctcagctcagacctccacaccagagcccaacagcactcacatg
cagtcagaggcccggagaggagaggggacacagagaaccacaccagctccagctgtcaga
atgatgaagatgaggaagagtttctcagccatcgtgcctacagcagacgtgatgagaagc
accatgagcacaacaacagaaccaccacagaccagtttctgtgggcaactcctgcttcaa
gactcaggaactatcgatctgcgcaacgtcactcaggccaggtgtatatttgctattggc
cgacctcttgatgaggttattcagatcaaaatcatatccagcactcttaactgccggcag
aaggagaacatcgccctgtatgacagactcatcctgatgcgtctctgtgagagaatgacc
agtaaaacgctgaaatcacaatcaaatgtcctactggtgcgtcagagccgcctgaccccc
ggcaatggagtgctgctattttatcagagcataaagaacaaaaaaagccaccatggagag
tgtgacgttcagctgttctctccgtctgggctcattgagaatccgatcaagagcgcagcc
acctctaacactcagagctgtcgcgtgttcatcgatgctccacctgctttcaggattcag
atcagagcgctttctgtgctcaacaacaccgatacaaactccacatacatactgattcgg
gatgtggatgccttaaagacgaccatcttcagagggactcggctcttcctgtggagctcc
tcgggaagcagggctgaagtggaattccatggggagtaccagcaaatcaagggcatgttc
agggtcgagtattcatacatgaacccttctgaagaacaaccagtgtag

DBGET integrated database retrieval system