KEGG   Sinocyclocheilus anshuiensis: 107703145Help
Entry
107703145         CDS       T04917                                 

Gene name
gpx8
Definition
(RefSeq) probable glutathione peroxidase 8 isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00480  Glutathione metabolism
sanh00590  Arachidonic acid metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107703145 (gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107703145 (gpx8)
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107703145 (gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SLT_2
Motif
Other DBs
NCBI-GeneID: 107703145
NCBI-ProteinID: XP_016361164
Position
Unknown
AA seq 210 aa AA seqDB search
MEALGGYPTKSTASRAGLIKVLLSVAVCMGSLYLLQSKLSKSRKAKDFYSYEVKDARGRT
VSLEKYRGKVSLVVNVASGRELTEQNYRALQELHRELGTSHFNVLAFPCSQYGDTESGTS
REIEAFAKSNYGVTFPIFSKIKIMGSEAEPAFRFITDSVQRIPKWNFWKFLVSPEGQVVR
FWKPEEPIGDIRKEATVLVRDIILKKRQEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaggctctcgggggataccccaccaaatcaactgcttctagagcaggactgatcaag
gtcttactgagtgtggccgtgtgcatgggctcactgtacctactgcagagtaaactgtca
aagtcgcgaaaagccaaagatttctactcgtatgaagtgaaggacgcgagaggcaggaca
gtctcattggagaagtatcgggggaaagtctctctggttgtaaacgtggcgagtggaagg
gagttgacggagcagaattaccgggctctgcaggagcttcaccgagagctcggcacgtct
cattttaacgtgctcgcctttccctgctcgcaatacggtgacaccgaatcaggtaccagc
cgagaaatcgaggcttttgccaaatccaactacggtgtgacattccccatcttcagcaag
atcaaaataatggggtctgaggcggagcccgcattcagattcatcacagattcagtacag
agaatccccaaatggaacttctggaagtttcttgtgagtcctgagggccaggtggtgcgt
ttctggaagccggaggagcccataggtgacatccgaaaggaagccacagtgcttgtgcgg
gatattatattgaagaagagacaggaactatga

DBGET integrated database retrieval system