KEGG   Sinocyclocheilus anshuiensis: 107703715
Entry
107703715         CDS       T04917                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) A-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107703715
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107703715
SSDB
Motif
Pfam: AstE_AspA RRM_1
Other DBs
NCBI-GeneID: 107703715
NCBI-ProteinID: XP_016361915
Position
Unknown
AA seq 291 aa
MCGASWPVEVRAAVTSAASCVKDDPGLLTEAGREERGKSLCRMFCMPCHTSPWHWHSCHQ
GQRAVKECRRYIDKDMNCCFTPLSRSSPITDSSPYEVRRAQELNNLLGPKGSTDAIDLIC
DLHNTTANMGLTLIHYTTSDWVTLARTSQTKITKVPVRVLVLDFPISDAYNFESVSRHGF
SIEVGPQPHGVVRADIYIIMKEAVDLTIDWIHKFNSGTVFEGGDVEAFKFIKSVDYPRDP
ETRTLTSAIHPQLQDRDFCLLMRGDPLFFTFSRETVKPLYDCLWWMSYHIL
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtgtggagcttcatggccagtggaagtgagagctgctgtgacatcagcagcatcatgt
gtgaaagatgatcctgggctgctgactgaagcaggcagagaagaacgaggtaaatcattg
tgtcgtatgttctgcatgccctgtcacacctcaccatggcattggcattcctgccatcag
gggcagcgggctgtgaaagagtgcagaagatacattgacaaggatatgaactgctgcttc
acacctctctctcgcagttctcctattacagacagcagcccgtatgaagtccggcgcgct
caggaactgaacaatctgctggggccgaaaggatccacagatgcaatcgacttgatctgt
gaccttcataacacgacggctaacatgggcctcacactgatccattacacgaccagtgac
tgggtgactctggcaagaacatcacaaactaagataaccaaagtgcctgtgagagtgctg
gtactggatttcccaattagtgacgcatataacttcgagtcagtatccaggcatggcttt
tcaatagaggtcgggccgcagccgcatggtgtcgtcagggctgacatctatatcattatg
aaagaggccgtagacttgacaatagactggatccacaaattcaactcaggaacggtgttt
gaaggcggggatgtggaagcctttaagtttatcaaaagtgtggattatccaagagatcca
gagactcggactctcacctctgccattcatcctcagctgcaggacagagacttctgtctc
ctcatgcggggagaccctttgttttttacattttctagagaaactgtgaagccactgtat
gattgtctttggtggatgtcctatcatatactctaa

DBGET integrated database retrieval system