KEGG   Sinocyclocheilus anshuiensis: 107704745
Entry
107704745         CDS       T04917                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107704745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107704745
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107704745
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED Zn-ribbon_8 zf-met
Other DBs
NCBI-GeneID: 107704745
NCBI-ProteinID: XP_016363220
Position
Unknown
AA seq 1252 aa
MRSKGRARKLTTGDGEDFSLFASDDLEEVGGVSDADPVPLATANDLPSPGLSGDAFSPVD
QSPFYPSFHTSVYLAGDGVESVPPDFEVRESAITRGTLGIWSRRRLEVGERLGPYEETSR
HIPENATQAWEGEQTGLDGSVCDSRSWLRHVQISPSTHQHNLTACQIHEQIFYRVVREVQ
PGEELLLFMKAEDFSCETMAPDIHEERQYRCEDCDLNFESGSELLDHQKHACGTLPSSGF
KLSKQGLPSAVDDPDLDPLHLHTHPLNLPCSPQECKECEQVFPDAQSLDAHSLSHSDERE
YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHAC
PDCGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDC
SQMFSTTSSLNKHRRFCEGKNHFAAAAGGLFAQGMALPGTPGLDKSVLAGMSHGSPGLAD
YFGTNRHHGGLTFPAAPPAFPFSFPGLFPSGLYHRPPLIPSTSPINGPPSGELRKSPLLS
SPISGSHDLLKSLRKDSFNGESESMEHQREGSVSKPRHGGKMSDQSESSDLDDVSTPSGS
ELESTSGSELDSEAESDRERVRENGKGPKRKSSGFNDAQSPTLVSSSSSSNTNNGKNLPV
PGLLPPSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGALPYPSMFPLSFF
PAFSPSVYPFPEREQLRPPGPKGEPESPPVEGKKLKGRNAESPFDLTTKRKEERLAATCA
PLKPEASHVQSTNQDQPLDLSLGGRSRGKSVRGEELKKNPVFGEERVEPEPPKADPSLQH
ARPTPFFMDPIYRVEKRKMNDPFEVLKDKYMRPTPGFLFHPQFRMPDQRTWMSAIENMAE
KLESFGSLKPDGGDIMRSVPSMFDFRAPPTTLPETLLRKGKERYTCRYCGKIFPRSANLT
RHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHL
KKHENGTAMSSPRSELDSGSAILEDKEDSYFNEIRNFISNTARNTTSPSHSEEGLNGSHF
DGDKALPGKGSRDLDEEEGEELRAEEEEAEHSDSARKPSEDGVPSSLDHDINDDIDFEGP
DDLEMNSKSSPQRFNEEEDDEDHSSFSTLDHIRHFSMEDGDLSDSDVTSFGPAHLQEGIK
QPLYRKSKSQAYAMMLSLADKDPLHSSTHNAPMWHSLARAAEPSAIQSLSHV
NT seq 3759 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcaaggaaactgaccactggagatggagaggacttctctctt
ttcgcctctgatgacctggaagaagttggcggagtgtctgatgcagatccagtcccactg
gccactgcaaatgaccttccgtcccctggcctatcaggtgatgcgttttccccagtcgac
cagtcccccttctacccgtcattccacacttcagtgtacctggccggggatggggtcgaa
tcggtgcccccagactttgaggtccgcgagtcagccattaccagaggaaccctgggcatc
tggagccggaggagactggaggtgggagaacgtctcggaccctatgaggaaacgtcaaga
cacatcccagaaaatgccacccaggcatgggagggcgagcagacaggtttggatgggagc
gtgtgtgatagcaggagctggctaaggcacgtccagatctctccatccacccaccaacac
aacctcacagcctgccagatacatgagcagatcttttaccgtgtggtccgagaggtccag
ccgggtgaggaactcttactgttcatgaaggctgaggatttttcatgtgagaccatggct
ccagacatacacgaggagcgtcaataccgttgtgaggactgtgacctgaactttgagtct
ggttcggagctgttggaccatcagaagcatgcatgcggtaccctgccttcctccggcttc
aagttgtctaagcagggtctgcccagcgccgtggacgatcctgatcttgacccgctgcac
ttacacactcaccccctgaacttaccctgctctccacaggagtgtaaggagtgtgagcag
gtctttcctgatgcccagagtctggacgctcactctctgtctcactccgatgagagggaa
tataaatgtgatcagtgtccgaaggccttcaactggaaatcaaacctgattcgccaccag
atgtcacatgacagcggcaagcattatgaatgtgaaaactgctcaaaggtgttcacagac
cccagtaacttgcagaggcacattcgctctcagcacgtaggggcgagagctcacgcctgc
cccgactgcggcaagaccttcgccacctcctcgggccttaaacaacacaaacacattcac
tcttccgtcaagcccttcatatgtgaggtctgccacaaatcttacacgcagttctccaat
ctgtgccgccacaagcgcatgcacgcggactgtcgcactcagatcaagtgcaaagactgc
agccagatgtttagcaccacgtcatccctaaacaagcatcggcgcttctgcgagggtaaa
aaccattttgctgctgccgcgggagggttgtttgcccagggcatggccctccctggcacc
cctggcctggacaaatccgtactggctggaatgagccatgggagtcctggtttagcagac
tattttgggacgaaccggcaccatggtgggctgacattcccagcagcccctccggcattc
ccattcagttttccaggacttttcccatcaggactttaccaccggccccctctaatccca
tccacgtcacctattaacggccctccgagcggtgaactacgaaagagtccgctgctgtct
tcacccatctctgggtcacatgacctcttgaagagtttacgcaaggattcgttcaacggg
gagagcgagagcatggagcatcaaagggaaggatccgtctccaaaccaaggcacggcggg
aagatgagtgaccagtcggagagtagcgatctggatgacgtcagcactccgagcgggagt
gagctggaaagcacttcaggttcagagttggacagcgaagcggaaagcgaccgggaacga
gtgcgggaaaacgggaaaggcccgaaaaggaagtccagcgggttcaacgatgcccaaagc
ccgactcttgtcagctccagtagtagtagcaacaccaataatggaaaaaacttgcctgtg
ccggggctcctcccgccatctttggacgagcaaacggctgtttctggtgccgttaatgac
tcgatcaaggcaattgcctccattgctgagaaatactttggttctactggacttgcaggc
ctgcaagataaaaaagttggggcattgccatacccttccatgttccctctgtctttcttc
cctgccttctctccatcagtctatcctttcccagaaagggagcaacttagacctccaggc
cccaaaggggagccagaaagccctccggttgagggtaaaaaacttaagggcagaaacgct
gaatcaccttttgacctcaccaccaaacggaaggaagaacgtcttgccgctacttgcgcc
cctttgaaaccggaagcctcacatgtacaatcaaccaaccaggatcaaccgctggacctg
agtctcggtggacgaagtcgaggaaagagtgtaagaggggaggagttaaaaaagaaccct
gtctttggagaggagagggtggaaccggagccacccaaggccgacccgtccctccaacac
gcaagacctacgcctttcttcatggatcccatttacagggttgagaagagaaagatgaac
gatcctttcgaagtcctcaaggacaagtatatgcggcccactcctggatttctcttccac
ccgcagtttcgcatgcctgatcagagaacatggatgtcggcgattgaaaacatggctgaa
aaactagaatccttcggctctttgaagccagacggcggtgacatcatgcgttccgttccc
tccatgttcgacttccgggctccgcccaccacccttcctgagacactgttacgcaaaggc
aaagagcgctacacctgcagatactgtggcaagatattcccacgctcagccaaccttaca
agacatctacggacacacacaggagagcagccttacagatgtaagtactgcgatcgttcg
ttcagtatttcgtcgaatcttcagcgtcacatccgtaacatccataacaaagagaaaccc
ttcaaatgccatctttgtgaccgctgcttcgggcaacaaaccaacctggaccggcacctc
aaaaagcacgagaacggcacggcaatgtcgtcgccccgttcagagctggacagtggcagt
gccatcttggaggacaaggaggactcgtattttaacgaaatacgaaacttcatcagtaac
acggcacggaacactacttctccgtcacactccgaggaagggctaaatggcagtcatttt
gatggcgacaaagccctgcctggtaaggggtcacgtgacctggatgaagaagaaggggag
gagctcagagcagaggaagaggaggcggagcatagcgacagtgccaggaaacccagcgag
gatggcgtgcccagcagtctggatcacgacataaacgatgacatcgatttcgagggacca
gatgatctggagatgaatagcaaatcctcgccacaaaggtttaatgaggaagaggacgat
gaagatcacagcagtttctccacgctggatcacatccgtcactttagtatggaggacgga
gacctcagcgacagtgatgtcaccagctttggccctgcccacctgcaagagggcatcaaa
cagcctctatacaggaaatctaaatcacaggcatatgctatgatgctgtccctagctgat
aaggatccactccattcgtctacccataatgccccgatgtggcacagcttggcccgcgct
gcagaacccagcgccattcagtctctcagtcacgtatga

DBGET integrated database retrieval system