KEGG   Streptococcus anginosus SA1: DK43_00380Help
Entry
DK43_00380        CDS       T03658                                 

Definition
(GenBank) alanine-phosphoribitol ligase
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00473  D-Alanine metabolism
sans01100  Metabolic pathways
sans01503  Cationic antimicrobial peptide (CAMP) resistance
sans02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK43_00380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK43_00380
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DK43_00380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sans01504]
    DK43_00380
Enzymes [BR:sans01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     DK43_00380
Antimicrobial resistance genes [BR:sans01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    DK43_00380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2
Motif
Other DBs
NCBI-ProteinID: AIK76863
UniProt: A0A3R8QY55
Position
75151..75390
Genome map
AA seq 79 aa AA seqDB search
MDVKAEVLEIIDDLFMEDVSDMMDEDLFDAGVLDSMGTVELIVELENHFDIHVPVSEFGR
DDWNTANKIIEGVTELRNA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaaaagcagaagtattagaaattattgatgatttgtttatggaagatgtatca
gacatgatggacgaagatttgtttgatgcaggagtcctggacagtatgggtactgtggaa
ttgattgttgagctagaaaaccattttgacatccatgttcccgtctcagaatttggtcgt
gatgattggaatacggctaataaaattattgaaggtgtaacggagcttcgcaatgcttaa

DBGET integrated database retrieval system