KEGG   Streptococcus anginosus SA1: DK43_02830Help
Entry
DK43_02830        CDS       T03658                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00471  D-Glutamine and D-glutamate metabolism
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK43_02830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sans01011]
    DK43_02830
Enzymes [BR:sans01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DK43_02830
Peptidoglycan biosynthesis and degradation proteins [BR:sans01011]
 Precursor biosynthesis
  Racemase
   DK43_02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AIK77299
UniProt: A0A418G6M0
Position
550088..550882
Genome map
AA seq 264 aa AA seqDB search
MDNRPIGFLDSGVGGLTVVRELMRQLPHEEVIYIGDSARAPYGPRPAEQIREYTWQLVQF
LLTKNVKMIVLACNTATAVVWEEIKEKLDIPVLGVILPGASAAIKASQHGTIGIIGTPMT
IQSDIYRQKIERLLPEVEVTSLSCPKFVPLVESNELSSSITKKVVYESLMPLKGKVDTLV
LGCTHYPLLKPIIQNVMGPAVKLIDSGAECVRDISVLLNYFEINHSREGELPQHRFFTTA
NAKSFAEIAETWLNKEINVEHVTL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggataatcgaccaattggttttttagactcaggcgtgggcggtttgacagttgttcgc
gagctgatgcggcagcttccacatgaggaagtgatttatatcggtgattctgcgcgtgcg
ccttatggtcctcgacctgcagagcagattcgtgagtatacatggcaattagtgcaattt
ctcttaactaaaaatgtcaaaatgattgttcttgcctgtaatacagctactgctgtggtt
tgggaagaaatcaaagaaaaattggatattccagttttgggagtgattttaccaggagct
agcgcagcaattaaagcttctcaacatgggacgattggcattattggaacgccaatgacg
attcaatcagatatttatcgtcagaaaatcgagcgtctcttaccagaagtggaggtgaca
agtctttcttgtcccaagtttgtaccactggtagagtctaacgagctgtcgtctagcatt
acgaaaaaagtggtctatgagagcttgatgccgttaaaaggcaaggtagatactttagtg
ctaggctgtacgcattatcctttgctaaaaccaatcattcaaaatgtaatgggaccagca
gtgaaactgattgatagtggagcagagtgtgtgcgggacatttctgtcttgcttaattat
tttgaaatcaatcacagcagagaaggagaacttcctcaacaccgcttttttaccacagca
aatgcaaaaagttttgctgaaattgcagaaacgtggttaaacaaagaaataaatgtggag
catgtgaccttatga

DBGET integrated database retrieval system