KEGG   Streptococcus anginosus SA1: DK43_03485Help
Entry
DK43_03485        CDS       T03658                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00561  Glycerolipid metabolism
sans00640  Propanoate metabolism
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DK43_03485
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    DK43_03485
Enzymes [BR:sans01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     DK43_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AIK77423
Position
684026..685114
Genome map
AA seq 362 aa AA seqDB search
MRTFASPSRYIQGEDALFENAKQILNLGNHPVLLCDNTVYQIVGKKFQSCLTRYGLHVLH
VSFNGEASDNEINRVATLAEKDGADLVIGLGGGKTIDSAKAIADLLGNPVVIAPTIASTD
APTSALSVIYTEEGAFEKYIFYTKNPDLVLVDSKVIAQAPKRLLASGIADGLATWVEARA
VMQANGETMLGQRQTLAGAAIAQKCEETLFADGLQALAACEAQVVTLALEHIIEANTLLS
GVGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLTQLFLEKRPKEELEKYIRFY
QKIGMPTTLAEMHLENASYDDLLKVGKQATIEGETIHQMPFKISASDIAGAILAVDRYVN
SL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttttgcaagcccttctcgctatattcaaggtgaagatgccttatttgaaaat
gcaaaacagattttgaacttaggaaaccatccagttttgctttgtgacaacactgtttat
caaattgtaggaaagaagttccaatcctgtcttactcgctatggacttcatgtattgcat
gtcagttttaatggtgaagcttcggataatgaaatcaatcgggtagctactttagctgaa
aaagatggagcagatctagtgattggtcttggtggtggaaaaacaattgacagtgctaag
gcaattgcagatttattgggaaatcccgtcgtgattgcaccgactattgcctcgacagat
gcaccaacatcagctctttcagtaatttataccgaggaaggagcatttgaaaaatatatt
ttttacaccaagaacccagatcttgttctagtagattcaaaggtcattgctcaagctcca
aagcgcttgttagcttctggaattgcagatggtttagcgacttgggttgaagcgcgtgcg
gttatgcaggcaaatggagagaccatgctgggacaaagacagactttagcaggcgcagct
attgctcaaaaatgtgaagaaactctttttgcagatggtttacaagcactggctgcttgt
gaggcgcaggtggtaacactagctcttgagcatatcattgaggctaatacgcttctcagc
ggtgttggttttgaaagtggtggattggctgctgctcatgccattcacaatggatttaca
gctctgactggtgatattcatcatctgactcatggagaaaaagtagcttatggaacgcta
acacagctctttcttgaaaaacgtccaaaagaggagttggaaaaatatattcgtttctat
cagaaaattggtatgcctacgactttggcagaaatgcatttagaaaatgccagctatgat
gatttgctcaaggttggtaagcaagctactattgaaggtgaaaccattcatcagatgccg
tttaagatttcagcatctgatattgcaggtgctatcctagcagtcgatcgttatgtaaac
tccttataa

DBGET integrated database retrieval system