KEGG   Streptococcus anginosus SA1: DK43_05430Help
Entry
DK43_05430        CDS       T03658                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00071  Fatty acid degradation
sans00072  Synthesis and degradation of ketone bodies
sans00280  Valine, leucine and isoleucine degradation
sans00310  Lysine degradation
sans00362  Benzoate degradation
sans00380  Tryptophan metabolism
sans00620  Pyruvate metabolism
sans00630  Glyoxylate and dicarboxylate metabolism
sans00640  Propanoate metabolism
sans00650  Butanoate metabolism
sans00900  Terpenoid backbone biosynthesis
sans01100  Metabolic pathways
sans01110  Biosynthesis of secondary metabolites
sans01120  Microbial metabolism in diverse environments
sans01130  Biosynthesis of antibiotics
sans01200  Carbon metabolism
sans01212  Fatty acid metabolism
sans02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK43_05430
   00630 Glyoxylate and dicarboxylate metabolism
    DK43_05430
   00640 Propanoate metabolism
    DK43_05430
   00650 Butanoate metabolism
    DK43_05430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK43_05430
   00072 Synthesis and degradation of ketone bodies
    DK43_05430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK43_05430
   00310 Lysine degradation
    DK43_05430
   00380 Tryptophan metabolism
    DK43_05430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK43_05430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK43_05430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK43_05430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sans04147]
    DK43_05430
Enzymes [BR:sans01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK43_05430
Exosome [BR:sans04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK43_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AIK77785
Position
1088789..1089967
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVSAVRTPLGSFGGSLKNISAVDLGSLVIKSALERANLKAEQVDEVIMGNVLGAG
LGQNVARQMSVNAGIPVTSPAFTVNKVCGSGLKTVQLAAQAILCGDADIIVAGGAENMSQ
APYVLQNQRWGSRMGDSKVVDTMLRDGLTDAFNDFHMGITAENVAAQYDISREVQDAFAV
QSQQRAVAAIEAGRFKEEIVPVVIPQRKGEPIIFDTDEFPRKDASLEGLAKLRPVFKEGG
TVTAGNASGINDGAAAVVVMSSEKAKELGIPVLATIKSYASAGLDPKIMGCGPIYASRKA
LEKGGFTVEDLDLIESNEAFAAQACAVGKELNFDPEKVNVNGGAIALGHPIGASGCRILV
TLLHEMEKRDAKRGLATLCIGGGMGTAVIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagttattgtatcagcagttcgtacaccattaggttcttttggtggaagt
ttgaaaaatatttcagctgttgatttgggaagtttggttatcaaaagcgcgctggaacga
gcaaatttgaaggctgaacaagttgatgaagtgattatgggaaatgttttaggggcagga
cttggtcaaaacgtggcacgtcaaatgagtgtcaatgcaggtatccctgtaacttctcca
gcattcacagtcaataaagtatgtggttcagggcttaaaactgttcagttggctgcacaa
gctatcctttgtggagatgctgatatcatcgtagcgggtggtgctgaaaatatgagccaa
gcaccatatgtgctgcaaaatcaacgttggggctctcgtatgggagactctaaagttgtt
gatactatgttgcgcgacggtctgactgacgcctttaatgatttccacatgggaatcaca
gctgaaaatgttgctgcacagtatgatatttctcgtgaagttcaagatgcttttgctgtg
caatctcaacaacgtgctgtggcagctattgaagctggacgtttcaaagaagaaattgtt
ccagtggttattccacaaagaaaaggtgagccaattatttttgatacggatgaatttcca
agaaaagatgcctcgttagaaggtttggctaaattgcgtcctgtctttaaagaaggtgga
actgtcacagctggtaatgcttctggtatcaatgacggagcagcagcagttgttgtcatg
agttcagaaaaagcaaaagaattaggcatccccgttttagcaactattaaatcatatgct
agtgcgggcttagatccaaaaatcatgggttgtgggccaatttatgcctctcgtaaagca
cttgaaaaaggtggttttacagttgaagaccttgatttgattgaatccaatgaagccttt
gcagctcaagcgtgtgctgttggaaaagagttgaattttgacccagaaaaagtaaacgtc
aatggcggagccattgcacttggtcatccaattggagcatcaggctgccgtattctggtt
actttgttgcatgaaatggaaaaacgcgatgctaaacgtggtcttgcaactctttgtatc
ggaggaggaatgggcacagcagtcattgtagaacgttaa

DBGET integrated database retrieval system