KEGG   Streptococcus anginosus SA1: DK43_07720Help
Entry
DK43_07720        CDS       T03658                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00450  Selenocompound metabolism
sans00970  Aminoacyl-tRNA biosynthesis
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DK43_07720
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DK43_07720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sans01007]
    DK43_07720
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sans03016]
    DK43_07720
Enzymes [BR:sans01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DK43_07720
Amino acid related enzymes [BR:sans01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DK43_07720
Transfer RNA biogenesis [BR:sans03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DK43_07720
 Prokaryotic type
   Other AARSs
    DK43_07720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AIK78221
Position
complement(1568278..1570275)
Genome map
AA seq 665 aa AA seqDB search
MTEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQK
AEEAGITPQAYVDSMAVGVKELWELLDISYDKFIRTTDDYHEKVVADVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLEEVFRDESGKVIGGIAPSGHEVEWVSEESYFLRLGKYADR
LVEFFHAHPDFIQPDGRMNEIIKNFIEPGLEDLAVSRTSFTWGVKVPSNPKHVVYVWIDA
LLNYATALGYGQDADANFEKFWNNGTVFHMVGKDILRFHSIYWPIMLMMLDMKLPDRLIA
HGWFVMKDGKMSKSKGNVVYPEILVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINY
ELANDLGNLLNRTVAMINKYFDGQVPIYKENVTEFDADLAAVVAENIAIYHKQMDAVDYP
RALEAVWNIISRTNKYIDETAPWVLAKDEAKRDELAAVMAHLVASLRVVAHLIQPFMMTT
SNAIMEQLGLGTDFDLENLDLAELPTGLTVVAKGTPIFPRLDMEEEIAYIKEQMEANKPA
IEKEWEPEEVELKLNRKEIKFDDFDKVEIRVAEVKEVSKVEGSDKLLQFRLDAGDGEDRQ
ILSGIAKYYPNEQELVGKKVQIVANLKPRKMMGRISQGMILSAEYGNQLTLLTVDQNVPN
GSLIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaagaatttttatattacaacgccaatttactatccaagcggtaagctccat
attgggagtgcttatacgaccattgcttgcgatgtccttgctcgttacaaacgtctcatg
ggttatgatgttttttatttgacagggcttgatgagcacggtcaaaagattcagcagaaa
gcggaagaagcaggtattacaccgcaagcctatgttgacagcatggcagttggtgttaag
gaactttgggaactccttgatatttcttacgataaatttatccgtacgacggatgattac
catgaaaaagtagtagcagatgtttttgaacgtctcttggctcaggatgatatttacttg
ggtgagtattcaggctggtactctgtttctgatgaagaatttttcactgaaagtcaatta
gaagaagtttttcgtgatgaatctggcaaggttatcggaggcattgccccatcaggccac
gaagtggaatgggtgtcagaagaatcttacttcttgcgtttgggtaaatatgccgaccgt
ttggtagaatttttccatgcccatccagattttattcagcctgatggccgtatgaatgaa
attatcaagaactttattgagccaggcttggaagatttggctgtatcgcgtacctcattt
acttggggggtaaaggtaccttccaatcctaagcacgtggtttacgtatggattgatgcc
cttctcaactatgcaacagctcttggctatggtcaagatgcagatgccaactttgaaaaa
ttctggaataatggaacagtcttccacatggttggaaaggatatcttgcgtttccactct
atctactggccaatcatgctcatgatgctggatatgaaattgccagatcgcttgattgcc
catggttggtttgtcatgaaggacggtaagatgtctaaatctaagggcaatgtcgtctac
ccagaaatactggtggaacgctttgggctggatccgcttcgctattatctcatgcgtagc
cttccagttggttctgacggcactttcacgccagaagactacgtgggtcgtatcaattat
gagctggcaaatgaccttggaaatctcctcaaccgtacggttgctatgattaacaagtat
tttgacggtcaagtgccgatttataaagagaatgtgacagaatttgatgcggacttggca
gcagtagtagcagaaaatatcgcaatctaccacaaacagatggatgccgtggactatcca
cgagccttggaagcagtgtggaatatcatttctcgtactaacaagtatattgacgaaaca
gcaccttgggtgttggctaaagatgaagccaaacgtgatgaattagcggcagttatggca
catttggtagctagtctacgtgtggtagctcatcttattcaaccgttcatgatgacgaca
tcaaatgctatcatggagcaacttggcttaggtacagattttgaccttgaaaatctagat
ttggcagaactgccaacaggcttgactgttgttgctaaaggtacacctatcttcccacgt
ctagatatggaagaagaaattgcttatatcaaggagcaaatggaagccaataagccagcc
attgaaaaggaatgggagccagaagaagtagaactcaaactcaaccgcaaggaaatcaag
tttgacgattttgacaaagtagaaatccgtgtcgcagaggttaaagaagtttctaaagtt
gaaggttctgataaattgcttcaattccgcttggatgcgggagacggcgaagatcgtcaa
attctgtctgggattgctaaatactatccaaacgagcaagaattggttggcaagaaagtc
caaatcgtagcgaacctcaaaccacgcaagatgatgggacgtatcagccaaggcatgatc
ctctcagcagaatatggtaatcaactaactctgctcacagtagatcaaaatgtaccaaat
ggtagcttgattgggtga

DBGET integrated database retrieval system