KEGG   Streptococcus anginosus SA1: DK43_07990Help
Entry
DK43_07990        CDS       T03658                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00471  D-Glutamine and D-glutamate metabolism
sans00550  Peptidoglycan biosynthesis
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK43_07990 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DK43_07990 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sans01011]
    DK43_07990 (murD)
Enzymes [BR:sans01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     DK43_07990 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sans01011]
 Precursor biosynthesis
  Amino acid ligase
   DK43_07990 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase 2-Hacid_dh_C Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: AIK78274
Position
complement(1625015..1626367)
Genome map
AA seq 450 aa AA seqDB search
MKHITNFANKKVLVLGLAKSGEAAARLLDKLGAIVTVNDGKPFEENPAAQSLLEEGIKVV
TGGHPLELLDEEFELMVKNPGIRYDNPMVARALEKKIPVITEVELAYLISDAPIIGITGS
NGKTTTTTMIAEVLTAGGQNGLLSGNIGFPASQVATTATQNDTLVMELSSFQLMGIETFH
PEIAVITNLMPTHIDYHGSFENYVAAKWNIQKNMSKSDFLILNFNQTLAKELAAKTQATV
VPFSTTEKVDGAYLEGNMLTFRGEPVMAADELGVPGSHNVENALATIAVAKLRGIENQVI
KETLAGFGGVKHRLQYVGEINHVKFYNDSKSTNILATQKALSGFDNSKVILIAGGLDRGN
EFDELVPDIQGVKKMVILGESAARVKRAADKAGVSYMDAADVKDATQKAFAEAQAGDIVL
LSPANASWDMYPNFEVRGDEFIATFEELKG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacattacaaattttgcaaataaaaaagtgttagttttaggcttggccaaatct
ggtgaagccgctgctcgtttactagataagttgggagcgattgttacagtgaatgacgga
aagccatttgaggaaaatcctgctgctcagtctcttcttgaggaaggtatcaaagtggta
acaggtggtcatcctttggaactcttggacgaagagtttgaactgatggtcaaaaatccc
ggtattcgttacgacaatcctatggtagcgagagctttggaaaagaaaatcccagtcatc
actgaagtggagttagcctatttgatttcagatgctccaattattgggattacgggctct
aatggaaaaacaacaacgacaacgatgattgcggaagtcttgactgcaggtggtcaaaat
ggtctgctttctgggaatattggctttccagccagtcaagttgcaacaaccgcaacccaa
aatgatacattggtcatggagttgtcttctttccaactcatgggcattgaaacctttcac
ccagagattgcagtgattactaatctgatgccaactcacattgattatcatggctctttt
gaaaattatgtcgctgctaaatggaacattcaaaaaaatatgagcaaatctgacttcctc
atattgaatttcaatcaaacattagcgaaagagctggctgcaaagacgcaagcgaccgtt
gtaccattttcaacgacagaaaaggtagacggcgcttacttagagggaaacatgttgacc
ttccgtggagagcctgttatggcagcagatgagcttggcgttccgggtagccataatgtt
gaaaatgcccttgcaactattgcagttgcgaaactgcgtggcattgaaaatcaagtcatc
aaagaaacattggcaggtttcggtggcgttaagcaccgccttcaatatgtcggtgaaatc
aaccatgttaaattttataacgatagtaaatcaacaaatattcttgcaacgcaaaaggct
ttgtctggttttgacaatagcaaggttatcttgattgctggtggactggaccgtggcaat
gaatttgacgaattggtgccagatattcaaggggtgaagaaaatggttattcttggagaa
tctgcagcacgtgtcaagagagcagcagataaagcaggtgttagttatatggatgctgct
gatgtgaaagatgcgacgcaaaaagcttttgctgaagctcaagcaggtgatattgttctt
ctcagtcctgcaaatgctagctgggatatgtatccaaattttgaagttcgtggcgatgaa
tttattgcaacatttgaagaattaaagggttaa

DBGET integrated database retrieval system