KEGG   Streptococcus anginosus SA1: DK43_09200Help
Entry
DK43_09200        CDS       T03658                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
sans  Streptococcus anginosus SA1
Brite
KEGG Orthology (KO) [BR:sans00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sans03009]
    DK43_09200
Enzymes [BR:sans01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     DK43_09200
Ribosome biogenesis [BR:sans03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DK43_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_18 Methyltransf_2 Methyltransf_8 Methyltransf_9 CMAS PrmA NNMT_PNMT_TEMT Methyltransf_4 FtsJ Ubie_methyltran DREV PCMT zf-Di19
Motif
Other DBs
NCBI-ProteinID: AIK78500
UniProt: A0A426SX78
Position
1871155..1871991
Genome map
AA seq 278 aa AA seqDB search
MKPKLKRFETAKLFSCPFCQQALFLSENSLKCKNKHSFDLAKFGYVNLAPQVKQSKDYDK
SNFQNRQLILEAGFYQPILKKLLEILSSLSQHDNLLDIGCGEGYYARNLQAQLPAKHIYA
FDLSKESIQLAAKSDHSLTVSWFVGDLAHIPIQDASMNVILDIFSPANYQEFQRVLRKNG
LLIKVIPSSQHLQEIRSIVAEQLTNTNYSNHKIIEHFEEAFTITNSYDVAATFSLRENEK
AALLHMTPLLFNIDIDKIDWSPLTDITIAAKILVGQQI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaaacttaaacgctttgaaacagctaagcttttttcttgccctttttgtcag
caagccttgtttttatcagaaaatagtctcaaatgcaaaaataagcattccttcgacttg
gcaaagtttggctatgtcaacttggctccacaggtgaagcaatcaaaagactacgataaa
tccaactttcaaaatcgacaattgattctcgaagcaggattttaccagccaattttgaag
aaattactagaaattttatcatctttatcacaacacgacaatctgctggacattggctgc
ggagaaggctattatgctcgaaatttgcaagcacaattgccagctaaacatatctatgca
ttcgatttatcaaaagagtctattcaactagcagccaaaagtgaccacagcctgacggta
agttggtttgttggagatctggcgcacatccctattcaagatgctagcatgaatgtgatt
ttagacatcttctctcccgccaattaccaagaatttcagcgcgtcttgcggaaaaacggc
ctgctcattaaggttattcctagcagccaacacttgcaagaaattcgtagtatcgttgcc
gagcaattaacaaacacaaattattccaatcacaaaatcattgagcattttgaagaagcc
tttaccattacgaattcttatgacgttgcagccactttcagcttgagagaaaatgagaaa
gcggcacttcttcacatgacaccgcttctttttaatattgacattgataaaatagattgg
tcaccattaactgacatcacgattgctgcaaagattttagttggtcaacaaatataa

DBGET integrated database retrieval system