KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00131
Entry
SAOUHSC_00131     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K09790  uncharacterized protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAOUHSC_00131
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-GeneID: 3919840
NCBI-ProteinID: YP_498731
UniProt: Q2G1J1
Position
complement(136458..136841)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgctttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system