KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00521
Entry
SAOUHSC_00521     CDS       T00324                                 

Gene name
rplL
Definition
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAOUHSC_00521 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sao03011]
    SAOUHSC_00521 (rplL)
Ribosome [BR:sao03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAOUHSC_00521 (rplL)
  Bacteria
    SAOUHSC_00521 (rplL)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-GeneID: 3920375
NCBI-ProteinID: YP_499094
UniProt: P48860
Position
520794..521162
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system