KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00676
Entry
SAOUHSC_00676     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K09705  uncharacterized protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAOUHSC_00676
SSDB
Motif
Pfam: Cupin_5
Other DBs
NCBI-GeneID: 3919439
NCBI-ProteinID: YP_499235
UniProt: Q2G0C9
Position
665592..666065
AA seq 157 aa
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa

DBGET integrated database retrieval system