KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00783
Entry
SAOUHSC_00783     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00564  Glycerophospholipid metabolism
sao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAOUHSC_00783
Enzymes [BR:sao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     SAOUHSC_00783
SSDB
Motif
Pfam: Hexapep_2 Hexapep
Other DBs
NCBI-GeneID: 3919073
NCBI-ProteinID: YP_499340
UniProt: Q2G043
Position
764955..765440
AA seq 161 aa
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgaggaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcgtcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga

DBGET integrated database retrieval system