KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00982
Entry
SAOUHSC_00982     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00130  Ubiquinone and other terpenoid-quinone biosynthesis
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAOUHSC_00982
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    SAOUHSC_00982
Enzymes [BR:sao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     SAOUHSC_00982
SSDB
Motif
Pfam: Chorismate_bind vATP-synt_E
Other DBs
NCBI-GeneID: 3920127
NCBI-ProteinID: YP_499535
UniProt: Q2FZL8
Position
953072..954283
AA seq 403 aa
MRLNDNRTSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQF
SSHKSDDEWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDI
DVDEQIGEITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQA
YSKEKNSYIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAF
LKDNKNLIEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYIS
LIDNLHPTPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKK
AQATLFAGCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcgtttgaatgataatcgaacgtcatattttggctacaaagcaattcaattattcaaa
aataattctaaaaataaacaatctatttttaaagactgggaaaaattaaaacataacatc
acatttatacatccgcaatctgagaaacatcatcttcgagttgttggagggttccaattt
tcaagtcataaatcagatgatgaatggcgagagtttggactaaatcattttgtattacct
gaagttttaatttcaactgataataatgggacatttttaacttatacagttaaaagggaa
agttttactgttgaggcattgaacgatttaatggatttgttcaacaatatatcggacata
gatgtggacgagcaaattggggaaattactagaaatgaagatatttataaagatgactgg
cgtcaacttgtagtagaagctatagaatctattaataatgaagaaaaaattgtactagca
cgtagacggttaataaagttcgataaagatatcagtattccatatattctaaagcaagca
tattctaaagaaaaaaacagttatatattcttgttagaatcacaagattctatattcttt
tcacaaacacctgaacaattaataaaggtcaataataaaatactatcgactaaagctgta
gcaggtacaattaaacgttcacaagatgaggacgaagatacaaaaaatgttgaagcattt
ttaaaagataataaaaacttaatcgaacatcgatttgttgttgacagtattttacatgat
attaaaccttatatcactgaattacattatgataagacgcctaaaattctaaaaaatgat
catttatatcacttgtacactgaaataaaggcgccactgaaggatgattcgtatattagt
ttaattgataatttacatccaacacctgctttaggtggctatccaaaagaatttgcaatg
gattttattgagcagaaagaatttggtacgcgaggattatatggtgcaccggttggctat
atagatatatacgatgattgtgaatttattgttgcaattcgttcgatgcttattaagaaa
gcacaagcaactttatttgctgggtgtggcattgttaaagattctgatccagatagtgaa
ttggcagaaacgaaccttaagttcacacctatgatgaatgcattaggagtcgatatgaat
gggaaatcataa

DBGET integrated database retrieval system