KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00983
Entry
SAOUHSC_00983     CDS       T00324                                 
Name
(RefSeq) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00130  Ubiquinone and other terpenoid-quinone biosynthesis
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAOUHSC_00983
Enzymes [BR:sao01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     SAOUHSC_00983
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 TPP_enzyme_C adh_short_C2
Other DBs
NCBI-GeneID: 3920128
NCBI-ProteinID: YP_499536
UniProt: Q2FZL7
Position
954270..955943
AA seq 557 aa
MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
QHQILYQKLSEMIHDTL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgggaaatcataaagcagctttaacgaagcaagtttttacatttgcatctgagttatat
gcgtacggcgtaagggaagtagttatcagtccgggatcacgctcaacgccacttgcactt
gcatttgaagcacatccaaatattaaaacatggatacaccccgatgagcgaagtgcagcg
ttttttgcagttgggttaattaaaggcagtgaaagacctgtcgctatattatgtacgtca
ggtacagcagcagcgaattatacgcctgcaattgctgaaagccaaattagtagaattcct
ttaatcgttttaacaagtgaccgtccgcatgaattaagaagtgtaggcgcaccacaagcg
attaatcaagtaaatatgtttaataattatgtaagttatgagttcgatatgcctattgcg
gatgatagtaaagagaccattgatgcaatttactatcaaatgcaaattgctagtcaatat
ttatatggaccacataaagggccaattcattttaacttgccatttagagatccgttaaca
cctgatttgaatgcaacagaattgttaacttctgagatgaagattttaccgcactatcaa
aaaagtatagatgcatcggcattaagacacattttaaataagaaaaaaggtttaattatt
gtaggggatatgcagcaccaagaagttgatcaaatactaacgtattcaacgatatatgat
ttgcctattttagctgatcctttaagtcatttaagaaaatttgatcatccgaatgttatc
tgtacatatgatttgctgtttagaagcggcttagacttaaatgtggatttcgtaattcgt
gttgggaaaccagtgatttctaaaaagttaaatcaatggttaaagaaaactgatgcattt
caaatattagtgcaaaacaatgataagattgatgtctttccgatagcgccagatatttca
tatgagatttctgcgaatgatttctttaggtcattaatggaagacacgacagttaatcgc
gtaagttggttagaaaaatggcaatgcttagagaaaaaagggcgtaaagaaattaaatgt
tatttggaacaagctacagatgagagtgcattcgttggtgaattgattaagaaaacatct
gaaaaagatgcattatttattagtaatagtatgcctatcagagatgtagataacttgtta
ttgaataaaaatatagatgtctatgcgaatcgtggtgcgaatggtattgatggtatcgtt
tcaactgcactgggtatggctgtgcataaacgaataacattattgataggtgatttatca
ttttatcatgatatgaatggactattaatgtcaaaattaaataatattcagatgaatatt
gtattattgaacaacgatggtggcggtattttttcatatttaccacaaaaagaaagtgca
actgactattttgaacggttgtttggcacaccgacgggattggatttcgagtatacagct
aagttatatcaattcgattttaaacgttttaacagtgtttcagaatttaaaaatgccaca
ttgttatctgaaacttcgacgatttatgaattgataacgaatcgcgaagataactttaaa
cagcatcaaattttataccagaaattgagtgaaatgattcatgacacattataa

DBGET integrated database retrieval system