KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00986
Entry
SAOUHSC_00986     CDS       T00324                                 

Name
(RefSeq) cysteine protease
  KO
K23597  staphostatin B
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sao01002]
    SAOUHSC_00986
Peptidases and inhibitors [BR:sao01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   SAOUHSC_00986
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-GeneID: 3920387
NCBI-ProteinID: YP_499539
UniProt: Q9EYW6 A0A2X3YDA9
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(957786..958115)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system