KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00988
Entry
SAOUHSC_00988     CDS       T00324                                 

Name
(RefSeq) glutamyl endopeptidase
  KO
K01318  glutamyl endopeptidase [EC:3.4.21.19]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sao00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAOUHSC_00988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sao01002]
    SAOUHSC_00988
Enzymes [BR:sao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.19  glutamyl endopeptidase
     SAOUHSC_00988
Peptidases and inhibitors [BR:sao01002]
 Serine peptidases
  Family S1: chymotrypsin family
   SAOUHSC_00988
SSDB
Motif
Pfam: Trypsin_2 Trypsin Peptidase_S46 Peptidase_S7 Peptidase_C3 Peptidase_S32 Peptidase_S39 Phytochelatin
Other DBs
NCBI-GeneID: 3920389
NCBI-ProteinID: YP_499541
UniProt: Q2FZL2
Structure
PDB: 
2O8L 1QY6 1WCZ

Position
complement(959416..960426)
AA seq 336 aa
MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
PDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaggtaaatttttaaaagttagttctttattcgttgcaactttgacaacagcgaca
cttgtgagttctccagcagcaaacgcgttatcttcaaaggctatggacaatcatccacaa
caaacgcagtcaagcaaacagcaaacacctaagattcaaaaaggcggtaaccttaaacca
ttagaacaacgtgaacacgcaaatgttatattaccaaataacgatcgtcaccaaatcaca
gatacaacgaatggtcattatgcacccgtaacttatattcaagttgaagcacctactggt
acatttattgcttccggtgtagttgtaggtaaagatactcttttaacaaataaacacgtc
gtagatgctacgcacggtgatcctcatgctttaaaagcattcccttctgcaattaaccaa
gacaattatccaaatggtggtttcactgctgaacaaatcactaaatattcaggcgaaggt
gatttagcaatagttaaattctcccctaatgagcaaaacaaacatattggtgaagtagtt
aaaccagcaacaatgagtaataatgctgaaacacaagttaaccaaaatattactgtaaca
ggatatcctggtgataaacctgtagcaacaatgtgggaaagtaaaggaaaaatcacttac
ctcaaaggcgaagctatgcaatatgatttaagtacaactggtggtaattcaggttcacct
gtatttaatgaaaaaaatgaagtgatcggaattcattggggcggtgtaccaaatgaattt
aatggtgcggtatttattaatgaaaatgtacgcaacttcttaaaacaaaatattgaagat
atccattttgccaacgatgaccaacctaataacccagataatcctgataaccctaacaat
cctgataaccctaacaacccagatgaaccaaataaccctgacaaccctaacaaccctgat
aatccagacaatggcgataacaataattcagacaatccagatgcagcttaa

DBGET integrated database retrieval system