KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00992
Entry
SAOUHSC_00992     CDS       T00324                                 

Name
(RefSeq) MarR family transcriptional regulator
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-GeneID: 3920392
NCBI-ProteinID: YP_499544
UniProt: A0A2X3YWJ7 Q2FZK9
Position
963467..963886
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system