KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00993
Entry
SAOUHSC_00993     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3920393
NCBI-ProteinID: YP_499545
UniProt: Q2FZK8
Position
963913..964023
AA seq 36 aa
MSLCTQQKLNHELQAKVAVIVKIDGKQSPLFLLVYV
NT seq 111 nt   +upstreamnt  +downstreamnt
gtgtcgttgtgcacacaacaaaaattgaatcatgaattacaagcaaaagtagcggtgatt
gttaaaattgatggtaaacaatcaccgctatttttgcttgtgtatgtataa

DBGET integrated database retrieval system