KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01123
Entry
SAOUHSC_01123     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Motif
Pfam: HTH_3
Other DBs
NCBI-GeneID: 3920724
NCBI-ProteinID: YP_499667
UniProt: Q2FZB4
Position
1078148..1078372
AA seq 74 aa
MLIQERGLKMTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
IIKLYSYYVSLKEH
NT seq 225 nt   +upstreamnt  +downstreamnt
ttgttaattcaagaaaggggattaaaaatgacagagttgaataatattataaactctctt
caatctttgtttgagtctgaatcaggctataaaatttcgaaaaattcaggagttccatat
caaacagtacaagatttaagaaatgggaaaaccaaactagaagatgctagatttagaacg
attattaaactttatagttactatgtctcattaaaagaacactaa

DBGET integrated database retrieval system