KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01124
Entry
SAOUHSC_01124     CDS       T00324                                 

Name
(RefSeq) superantigen-like protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: SSL_OB Stap_Strp_tox_C
Other DBs
NCBI-GeneID: 3920725
NCBI-ProteinID: YP_499668
UniProt: Q2FZB3 A0A2X4ANY6
Position
complement(1078816..1079532)
AA seq 238 aa
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag

DBGET integrated database retrieval system