KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01206
Entry
SAOUHSC_01206     CDS       T00324                                 

Definition
(RefSeq) DNA-binding protein
  KO
K09787  uncharacterized protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAOUHSC_01206
SSDB
Motif
Pfam: UPF0122 Sigma70_r4 Sigma70_r4_2 HTH_38 HTH_11 HTH_23 Sigma70_ECF HTH_Tnp_1_2 HTH_7 HTH_10 HTH_28 HTH_17 TrmB HTH_40 HTH_29 DUF1492 Terminase_5 HTH_22 GerE Syntaxin-6_N AAA_23
Other DBs
NCBI-GeneID: 3919472
NCBI-ProteinID: YP_499743
UniProt: Q2FZ47
Structure
PDB: 
1XSV

Position
1157575..1157907
AA seq 110 aa
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
NT seq 333 nt   +upstreamnt  +downstreamnt
atgggtcaaaatgatttagttaaaacgttacgaatgaattatttgtttgatttttatcaa
tccttattgacgaataaacaacgtaattatttggaattattttatcttgaagattattct
ttaagtgaaatcgcagatacttttaatgtgagtagacaagcagtttatgataatataaga
agaactggcgatttagttgaagattatgaaaagaaattggaattataccagaaatttgag
caacgccgagaaatatatgatgaaatgaaacaacatttaagtaatccagaacaaatacaa
cgttatattcaacaattagaagacttagaatag

DBGET integrated database retrieval system